Next Article in Journal
Infant Botulism: Checklist for Timely Clinical Diagnosis and New Possible Risk Factors Originated from a Case Report and Literature Review
Next Article in Special Issue
Local Cytotoxic Effects in Cobra Envenoming: A Pilot Study
Previous Article in Journal
Recombinant Production and Characterization of a New Toxin from Cryptops iheringi Centipede Venom Revealed by Proteome and Transcriptome Analysis
Previous Article in Special Issue
Neutrophil Gelatinase–Associated Lipocalin Acts as a Robust Early Diagnostic Marker for Renal Replacement Therapy in Patients with Russell’s Viper Bite–Induced Acute Kidney Injuries
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Isolation and Characterization of A2-EPTX-Nsm1a, a Secretory Phospholipase A2 from Malaysian Spitting Cobra (Naja sumatrana) Venom

1
Jeffrey Cheah School of Medicine and Health Sciences, Monash University Malaysia, Jalan Lagoon Selatan, Bandar Sunway, Subang Jaya 47500, Malaysia
2
Centre for Tissue Engineering and Regenerative Medicine, Faculty of Medicine, Universiti Kebangsaan Malaysia, Jalan Yaacob Latif, Bandar Tun Razak, Kuala Lumpur 56000, Malaysia
3
Kulliyyah of Pharmacy, Kuantan Campus, International Islamic University Malaysia, Bandar Indera Mahkota, Kuantan 25200, Malaysia
4
Monash Venom Group, Department of Pharmacology, Biomedical Discovery Institute, Monash University, Clayton, VIC 3800, Australia
*
Authors to whom correspondence should be addressed.
Toxins 2021, 13(12), 859; https://doi.org/10.3390/toxins13120859
Submission received: 15 October 2021 / Revised: 22 November 2021 / Accepted: 27 November 2021 / Published: 2 December 2021
(This article belongs to the Special Issue Venom-Induced Tissue Damage)

Abstract

:
Phospholipase A2 (PLA2) toxins are one of the main toxin families found in snake venom. PLA2 toxins are associated with various detrimental effects, including neurotoxicity, myotoxicity, hemostatic disturbances, nephrotoxicity, edema, and inflammation. Although Naja sumatrana venom contains substantial quantities of PLA2 components, there is limited information on the function and activities of PLA2 toxins from the venom. In this study, a secretory PLA2 from the venom of Malaysian N. sumatrana, subsequently named A2-EPTX-Nsm1a, was isolated, purified, and characterized. A2-EPTX-Nsm1a was purified using a mass spectrometry-guided approach and multiple chromatography steps. Based on LC-MSMS, A2-EPTX-Nsm1a was found to show high sequence similarity with PLA2 from venoms of other Naja species. The PLA2 activity of A2-EPTX-Nsm1 was inhibited by 4-BPB and EDTA. A2-EPTX-Nsm1a was significantly less cytotoxic in a neuroblastoma cell line (SH-SY5Y) compared to crude venom and did not show a concentration-dependent cytotoxic activity. To our knowledge, this is the first study that characterizes and investigates the cytotoxicity of an Asp49 PLA2 isolated from Malaysian N. sumatrana venom in a human neuroblastoma cell line.
Key Contribution: The characteristics of a secretory PLA2 from the venom of the Malaysian spitting cobra, Naja sumatrana, and its cytotoxicity in the human neuroblastoma cell line, SH-SY5Y, are reported for the first time.

1. Introduction

Naja sumatrana (Sumatran cobra or Sunda spitting cobra) is a diurnal spitting cobra endemic in Malaysia, Singapore, Southern Thailand, Indonesia (Sumatra and Kalimantan), and the Philippines (Palawan and Calamianes Archipelago) [1,2]. N. sumatrana is considered to be a medically important species in the countries where it is found [3]. Systemic envenoming caused by N. sumatrana results in generalized paralysis, leading to death in the absence of proper clinical management and antivenom administration. Envenoming can also cause prominent localized dermonecrotic damage, causing morbidity due to disfigurement [4].
A venomic study of Malaysian N. sumatrana venom showed that the venom consists mainly of three-finger toxins and phospholipase A2 (PLA2) components [5]. Information on the activity of PLA2 toxins from N. sumatrana venom is lacking despite these components being one of the main constituents of the venom. Indeed, PLA2s are ubiquitous components in many snake venoms. Snake venom PLA2s are classified as secretory PLA2s and are divided into Group I and Group II based on their molecular weight, calcium-dependency, and catalytic residues [6]. Commonly, position 49 in the primary structure is composed of aspartic acid. However, in some species, this amino acid residue is replaced by lysine, arginine, asparagine, serine, or, rarely, cysteine. Modification at this position alters the enzymatic activity of the PLA2 by modifying its Ca2+ binding dependency [7] and contributes to causing a different type of toxicity [8].
PLA2 toxins isolated from elapid and viperid snake venoms have been reported to cause muscle necrosis [8,9,10,11,12,13,14,15,16], induction of inflammatory cytokines [9,12,15,17,18,19,20,21], neurotoxicity [15,22,23,24,25], edema [9,14,18,19,21], hypotension [26], vasoconstriction [27], hemolysis [28], pulmonary congestion [12], intraperitoneal bleeding [12], and acute kidney injury [29]. Some snake venom PLA2s have been reported to have potential therapeutic activities including anti-cancer [30,31,32,33,34,35], anti-angiogenic [36], antibacterial [37,38], anti-parasite [39], antithrombotic [40], anticoagulant [8,12,28,40,41], antiviral [42], neuronal survival [43], and platelet inhibition [44]. The mechanism of these activities depends on the targeted cells [45].
N. sputatrix was the previous taxonomical classification for the spitting cobra in the Malaysia–Singapore region [5]. However, only four sequences of PLA2 have been deposited in UniProt under the species name N. sputatrix [46,47,48]. Three isoforms of the PLA2 gene belonging to the acidic and neutral PLA2 gene (described NAJPLA-2A, NAJPLA-2B, and NAJPLA-2C) in N. sputatrix venom have been previously reported [46].
In this study, we have isolated, purified, and characterized a PLA2, that we named A2-EPTX-Nsm1a, from Malaysian N. sumatrana venom. The cytotoxicity of the PLA2 was determined using a neuroblastoma cell line. Information from this study will enhance the current knowledge on PLA2 in N. sumatrana and their activities.

2. Results

2.1. Purification of A2-EPTX-Nsm1a

A2-EPTX-Nsm1a was purified using a mass spectrometry-guided approach and sequential fractionation steps using gel filtration and reverse-phase chromatography. Crude venom separation using Sephadex™ G50 resulted in four fractions with fraction 2 containing a protein with a high degree of sequence similarity with PLA2 using ESI-LC-MS/MS analysis (Figure 1a). Further fractionation of fraction 2 using Superdex™ G75 yielded two distinct peaks (P1 and P2, Figure 1b) with peak 1 containing PLA2 based on ES-LC-MS/MS analysis. Peak 1 was further separated using reverse-phase chromatography and yielded two distinctive peaks labelled NPlTx-I and APlTx-II (Figure 1c, Supplementary data). Additional reverse-phase chromatography of NPlTx-I showed the presence of a single peak named A2-EPTX-Nsm1a based on the proposed nomenclature [49,50] (Figure 1d). The yield of A2-EPTX-Nsm1a at the end of the chromatographic steps was 7.1% based on the PLA2 specific activity.

2.2. SDS-PAGE

SDS-PAGE analysis for A2-EPTX-Nsm1a indicated a molecular weight of approximately 13–15 kDa under reduced and non-reduced conditions (Figure 2). Only a single band was seen for lanes loaded with A2-EPTX-Nsm1a (Figure 2).

2.3. Intact Protein Using Accurate Mass LC-MS

Intact protein analysis using accurate mass LC-MS showed A2-EPTX-Nsm1a has a molecular weight of 15,606.12 Da (Figure 3). The tested sample showed the absence of other dominant proteins from 13,100–15,700 Da (Figure 3).

2.4. Protein Identification by ESI-LC-MSMS

ESI-LC-MSMS analysis on an excised SDS-PAGE band of A2-EPTX-Nsm1a revealed its sequence similarity with other PLA2 from Naja species (Table 1). The amino acid sequence was determined using SPIDER mode in PEAKS Studio X+ as below. Amino acids highlighted in grey and underlined are computationally detected in SPIDER mode and de novo sequencing, respectively.
1                                     50
NLYQFKNMIQCTVPNRSWW HFADYGCYCGRGGSGTPVDDLDRCCQIHDNC
51                                   100
YNEAEKISRPYFKTYSYECSQGTLTCKGGNNACAAAVCDCDRLAAICFAG
101         115
APYNDNNYNIDLKAR
Multiple sequence alignment using the Clustal Omega program showed that the de novo sequence of A2-EPTX-NSm1a showed 76% sequence coverage with a neutral PLA2 muscarinic inhibitor from Naja sputatrix venom. The sequence also showed similarity with neutral PLA2 B from Naja sputatrix venom and other acidic phospholipase A2 from N. sputatrix, N. kaouthia, N. naja, N. atra, and N. sagittifera venoms (Table 1 and Figure 4).
Further analysis of the A2-EPTX-NSm1a peptide on its sequence function was performed using PROSITE (https://prosite.expasy.org accessed on 21 April 2021) to verify its catalytic site. A2-EPTX-NSm1 peptide at position 44–51 (CCQIHDNC) indicated a PLA2 histidine active site. Meanwhile, the A2-EPTX-NSm1a peptide at position 88–98 (VCDCDRLAAIC) is associated with the PLA2 aspartic acid active site. The estimated isoelectric point (pI) of A2-EPTX-Nsm1a obtained from Uniprot is 6.07.

2.5. Molecular Modelling

The molecular modelling structure using the Swiss Model (https://swissmodel.expasy.org accessed on 21 April 2021) showed A2-EPTX-Nsm1a sequence matched with PLA2 from Naja naja saggitifera venom (SMTL ID: 1yxh.1). A rainbow-colored cartoon showed the N-terminal sequence (start with blue) to C-terminal sequence (end with red) (Figure 5a). The secondary structures of α-helix (colored with purple) and β-sheet (colored with green) and Ca2+ binding loops were determined in this 3D model (Figure 5b,c). The 12 cysteine residues along the sequence interacted to form six disulphide bridges proposed in this model (Figure 5d,e).

2.6. PLA2 Activity

Venom and all PLA2-rich fractions showed PLA2 activity except APlTx-I, which showed low PLA2 activity (Supplementary Figure S3). However, the PLA2 activity of the venom and PLA2-rich fractions were lower than in the bee-venom-positive control (461.7 ± 44.2 µmol/min/mg) (Supplementary Figure S3). A2-EPTX-Nsm1a has higher PLA2 activity (87.1 ± 5.6 µmol/min/mg) compared to the crude venom (44.6 ± 3.1 µmol/min/mg) (Figure 6a). His48 modification using 4-BPB and EDTA significantly reduced PLA2 activity of A2-EPTX-Nsm1a compared to the native protein (Figure 6b,c).

2.7. Cytotoxicity Activity of A2-EPTX-NSm1a on SH-SY5Y

The cytotoxic effects of A2-EPTX-NSm1a in the neuroblastoma cell line SH-SY5Y were determined using different protein concentrations. The EC50 was determined from a plotted graph then estimated based on the data. The EC50s of A2-EPTX-NSm1a and N. sumatrana crude venom were 195.5 ± 32.4 µg/mL and 8.2 ± 0.3 µg/mL, respectively. The results showed that A2-EPTX-NSm1a was less toxic to SH-SY5Y than its crude venom (Figure 7).

3. Discussion

Previous work has shown that the protein composition of N. sumatrana venom is relatively less complex than the composition of N. kaouthia venom [51,52]. The unique composition of spitting cobra venom, compared to the venom of non-spitting species, has likely evolved due to the defensive role of the venom in the former [53]. PLA2 toxins are highly expressed in spitting cobra venom and have been shown to activate sensory pain in neurons as a protective mechanism against aggressors [53]. In this work, we have isolated a PLA2 named A2-EPTX-Nsm1a, from Malaysian N. sumatrana venom, using a mass spectrometry-guided approach and chromatography techniques. Size exclusion and reverse-phase chromatography used in this study have been previously used to isolate various types of proteins from snake venom [9,54]. Multiple chromatography steps are usually necessary to isolate a particular toxin from venom due to the complexity of the venom composition [55,56,57]. To the best of our knowledge, the activity of the isolated proteins from N. sumatrana venom in neuronal brain cells has never been reported. Therefore, cytotoxicity of A2-EPTX-Nsm1a in the SH-SY5Y neuroblastoma brain cell line was determined.
Electrophoresed A2-EPTX-Nsm1a in reduced and non-reduced conditions showed a single band in the silver-stained SDS-PAGE gel. The gel indicates that A2-EPTX-Nsm1a is a monomeric PLA2. It was further confirmed, by intact protein analysis using LC-MSMS, that the determined mass of the 115 amino acid sequence of A2-EPTX-Nsm1a was 15,606 Da. These features are consistent with previously reported monomeric snake venom secretory PLA2 [58,59] that consist of 115–125 residues, with a lower molecular weight ~15KDa compared to other PLA2 classes [58,59,60]. Close examination of the predicted structure of A2-EPTX-NSm1a showed a similar structural arrangement with other snake venom PLA2. (Figure 5). Alignment of the A2-EPTX-Nsm1a sequence, obtained from ESI- LC-MSMS analysis, with other snake venom proteins in the UniProt database showed sequence similarity with different secretory PLA2 isolated from N. sputatrix, N. kaouthia, N. atra, N. naja, and N. sagitiferra venoms (Table 1). The primary sequence of A2-EPTX-Nsm1a has 76% sequence coverage with the neutral PLA2 muscarinic inhibitor (Q92084) (Table 1). These findings indicate that the molecular features and function of A2-EPTX-Nsm1a could be identical to the neutral phospholipase PLA2 muscarinic inhibitor.
PLA2 belongs to a large protein superfamily that differ in their amino acid sequences and positions of disulfide bonds. Secretory PLA2 derived from cobra venom are classified as group I PLAs. This group shares distinct structural characteristics of three long α-helices, two β-strands, and a Ca2+ binding loop [61]. Similarly, molecular modelling using a homologous PLA2 template (SMTL ID: 1yxh.1) showed identical structural characteristics (Figure 5a–c.). Although the molecular modelling predicted that A2-EPTX-Nsm1a has seven disulfide bridges, only 12 cysteine residues were detected in the primary sequence of A2-EPTX-NSm1a by LC-MSMS analysis (Figure 5d,e). This finding confirmed the characteristic of secreted PLA2 as globular cysteine-rich proteins with 6 to 8 disulfide bonds that ensure enzyme stability and resistance to proteolysis and denaturation. The presence of active sites is essential in PLA2 catalytic action, with this activity dependent on calcium ions as a cofactor [62,63]. Function prediction using PROSITE indicates that A2-EPTX-Nsm1a is an Asp49 PLA2, a type of PLA2 commonly found in snake venoms [10,27,64]. This aspartic active site is vital for the snake venom PLA2 catalytic network with His48, Tyr52, and Tyr64 residues [65]. The N-terminal amino acid residues of lipophilic residues, namely Leu2, Phe5, and Ile9, are highly conservative substrate regions with a hydrophobic site [66,67]. These amino acids were also found in the sequence of A2-EPTX-Nsm1a. The primary structure of A2-EPTX-Nsm1a showed the presence of a Ca2+ binding loop that accommodates a glycine-rich sequence (Tyr24-Gly25-Cys26-Tyr27-Cys28-Gly29-Arg30-Gly31-Gly32-Ser33-Gly34). The formation of a Ca2+ binding loop with Tyr28, Gly30, Gly32, and Asp49 in its secondary structure generated in SWISS-MODEL indicated its dependency on Ca2+ to stabilize the catalytic conformation (Figure 5d).
PLA2 isolated from cobra venom shares a similar structure with pancreatic PLA2 [61]. Thus, these PLA2 are classified as Group I PLA2, and are further divided into Group IA and IB. The insertion at positions 54–56, called elapid loop residues, which link α-helices and β-sheets, differentiates between Group IA and IB [61]. These elapid loop residues of Glu-Ala-Glu were identified in the A2-EPTX-Nsm1a sequence, suggesting that A2-EPTX-Nsm1a should be grouped in Group 1A with other cobra and krait PLA2. Unlike other PLA2 in the database, the primary sequence of A2-EPTX-NSm1a obtained using LC-MSMS does not have signal and pro-peptides (Figure 4). Therefore, N-terminal peptide sequencing using Edman degradation is required to confirm the complete amino acid for future work. The PLA2 activity of N. sumatrana venom has been determined in a previous study [68] and was also measured in this study (Figure 6a). A2-EPTX-Nsm1a was found to have approximately two times higher PLA2 activity compared to N. sumatrana venom (Figure 6a). Coincubation of A2-EPTX-Nsm1a with the chelating agent EDTA attenuated PLA2 activity (Figure 6b). Snake venom PLA2 is a Ca2+-dependent enzyme, and inhibition by EDTA would be reversed by restoration of the Ca2+ concentration [69]. This finding demonstrated the importance of metal ions for PLA2 action. Modification at His48 by bromophenylation of A2-EPTX-Nsm1a, using 4-BPB, also abolished PLA2 activity, indicating the importance of His-48 in the PLA2 activity of A2-EPTX-Nsm1a [70,71]. Various studies on neurotoxic and myotoxic PLA2 toxins have shown that His-48 played an essential role in PLA2 activity [71,72].
The neuroblastoma cell line SH-SY5Y has been used widely in neurobiology studies [73,74]. Cultures of SH-SY5Y contain two morphologically distinct phenotypes: Neuroblast-like cells and epithelial-like cells from its parental SK-N-SH cells [74,75]. N-type in SH-SY5Y has been reported to display characteristics of catecholaminergic neurons, such as the expression of tyrosine hydroxylase and dopamine-β-hydroxylase [74,75]. SK-N-SH cells also provide advantages in maintenance and cost compared to primary neurons and their human-derived cell line. In addition, the used of SH-SY5Y allows neurobiological studies on specific human proteins, which are not available in cell lines from other origins [74]. Even though SH-SY5Y can differentiate to mature neuron cells, both undifferentiated and differentiated SH-SY5Y have been utilized in cell culture models that require neuron-like cells [73,75,76,77,78,79,80,81]. In this study, A2-EPTX-Nsm1a demonstrated cytotoxic activity in undifferentiated SH-SY5Y. However, the cytotoxic effect of A2-EPTX-Nsm1a was less potent compared to N. sumatrana crude venom (Figure 7). This finding suggests A2-EPTX-Nsm1a is less toxic to the undifferentiated SH-SY5Y. Significant cytotoxic effects from N. sumatrana crude venom may be due to the presence of other toxins such as cytotoxins, cardiotoxins, and other types of PLA2 [5], which may have synergistic or potentiating effects [13]. Based on the findings from past studies, the enzymatic activity of PLA2 may contribute to the cytotoxic effect [82,83]. It has been reported that the Asp49 variant PLA2s are less toxic at the cellular level when compared with PLA2s with Lys49 [13,45]. The current study only used one type of cell line, and A2-EPTX-Nsm1a activity towards other cell lines is unknown. The role of His-48 and the calcium ion in the cytotoxic, neurotoxic, and myotoxic activities of the toxin were also unable to be determined due to the limited amount of purified toxin.

4. Conclusions

In conclusion, we have isolated and characterized A2-EPTX-Nsm1a, a secretory PLA2 from Malaysian N. sumatrana venom. To our knowledge, this is the first study reporting the cytotoxicity of secretory PLA2 from N. sumatrana venom on human neuron-like cells, SH-SY5Y. Further work is required to determine the mechanism of toxicity and its relationship with PLA2 activity using different types of cell lines and other in vitro methods. The study provided additional information on the effects of snake venom PLA2 in a neuronal cell line.

5. Materials and Methods

5.1. Chemicals

Ammonium acetate, acrylamide, N, N’-Methylenebisacrylamide, Tris-HCl, silver nitrate, and 4-bromophenacyl bromide were purchased from MERCK, Kenilworth, NJ, USA 1,4-Dithiothreitol, iodoacetamide, trifluoroacetic acid, formic acid, and thiazolyl blue tetrazolium bromide were purchased from SIGMA-Aldrich. EDTA was purchased from Promega, Madison, WI, USA, USA and Pierce™ Trypsin Protease MS Grade was purchased from Thermo Fischer Scientific, NY, New York USA. Dulbecco Modified Essential Medium (DMEM), High Glucose, fetal bovine serum, and antibiotic-antimycotic used for the cell culture were purchased from Gibco, New York, NY, USA.

5.2. Crude Venom

Pooled crude venom of N. sumatrana (n = 5) was obtained from Perlis, Northwest of Peninsular Malaysia. Snakes were milked using a sterile container covered with parafilm. The venom was transported on ice and immediately frozen at −80 °C when it arrived at Monash University Malaysia and freeze-dried using a FreeZone Benchtop Freeze Dry System (Labconco, KS, USA). Freeze-dried venom was weighed, labelled, and stored at −20 °C before use. When required, snake venom was dissolved in Milli-Q water unless stated otherwise. The research permit for venom collection was obtained from the Department of Wildlife and National Parks Peninsular Malaysia, Ministry of Energy and Natural Resources (HQ-00067-15-70).

5.3. Purification of A2-EPTX-Nsm1a

First, 30 mg of crude venom was dissolved in Milli-Q water and centrifuged at 1000 rpm for 5 min. Supernatants were collected, filtered using a syringe filter, and loaded into a C 16/100 column (GE Healthcare Life Sciences, Uppsala, Sweden) packed with Sephadex™ G-50 Fine (GE Healthcare Life Sciences, Uppsala, Sweden). The column was mounted onto the Äkta Prime Plus System (GE Healthcare Life Sciences, Uppsala, Sweden). The column was equilibrated with 0.1 M ammonium acetate, pH 6.8, and run at a 0.2 mL/min flow rate. The elution was monitored at 280 nm and collected automatically with 2 mL/tube. The fractions containing A2-EPTX-Nsm1a were pooled and freeze-dried. Then, 10 mg of the fraction was loaded into a Superdex™ 75 10/300 GL column (GE Healthcare Life Science, Uppsala, Sweden) and mounted onto the Äkta Purifier system (GE Healthcare Life Sciences, Uppsala, Sweden). The column was equilibrated with 0.1 M ammonium acetate, pH 6.8, and run at a flow rate of 0.1 mL/min, and the elution was monitored at 280 nm. The elution was collected automatically with 1 mL/tube by the system. The fraction containing the toxin from the second step was loaded on a Jupiter® C18 reverse-phase column (Phenomenex, CA, USA) mounted on an Agilent 1260 high-pressure liquid chromatography (HPLC) system (Agilent Technologies, Santa Clara, CA, USA). The column was equilibrated with 5% acetonitrile (ACN) with 0.1% trifluoracetic acid (TFA) in water and run at a flow rate of 0.5 mL/min. The elution was monitored at 214 nm. The toxin was eluted with an increasing percentage of 90% ACN in 0.1% TFA in water using the following gradient: 5% for 5 min, 5–20% over 15 min, 20–40% for 40 min, 40–95% for 10 min, and continued for 30 min and 100–5% for 20 min. The peaks were automatically collected.

5.4. Protein Quantification by Bicinchoninic Acid (BCA) Assay

The protein concentration from every fractionation and purification process was measured using the Pierce™ BCA Protein Assay Kit (Thermo Fischer Scientific, IL, USA) as the manufacturer’s manual instructed. In brief, the sample (25 μL) or standard (25 μL) was loaded onto a 96-well plate in triplicate before 200 μL of the reagent buffer mix was added to each well. The plate was incubated at 37 °C for 30 min and then read at 562 nm using an EON™ microplate spectrophotometer (BioTek Instruments, VT, USA). The protein concentrations of the venom and fractions were estimated from the protein concentration standard curve.

5.5. Sodium Dodecyl Sulphate-Polyacrylamide Gel Electrophoresis (SDS-PAGE)

SDS-PAGE was performed as described in the previous method [84]. Briefly, 5 μg of the sample was treated with reducing and non-reducing sample buffers and loaded in separate wells using 10% glycine-acrylamide gel. The Spectra Multicolor Broad-Range Protein Ladder (Thermo Fischer Scientific, IL, USA) was used as the molecular weight marker. Protein bands were separated at 60V for 30 min and 120V for about 1.5 h using the Hoefer SE260 system (Hoefer Inc, MA, USA). The gel was then stained using silver staining, and the image was captured using the GE Image Scanner III Labscan 6.0 (GE Healthcare Life Sciences, Uppsala, Sweden).

5.6. Intact Protein Analysis with Electrospray-Ionisation Coupled with Mass-Spectrometry

The protein was loaded onto an Agilent Zorbax Eclipse XDB-C18 chip column mounted on the Agilent 1290 Infinity LC system coupled to the Agilent 6520 Accurate-Mass Q-TOF mass spectrometer with a dual ESI source (Agilent Technologies, Santa Clara, CA, USA). The chip column was run at 0.5 mL/min using 0.1% formic acid in water (solution A) and 0.1% formic acid in acetonitrile (solution B). The chip was equilibrated with 5% solution B, and the gradient used during the run was 5–100% solution B for 5 to 20 min and maintained with 100% buffer B for another 5 min. The polarity of the Q-TOF was set at positive, the capillary voltage at 4000 V, the fragmentor voltage at 125 V, the drying gas flow at 10 L/min, and a gas temperature of 300 °C. The intact protein spectrum was analyzed in MS-only mode with a range of 100–3200 m/z. The spectrum was deconvoluted using Agilent MassHunter Qualitative Analysis B.07.00 (Agilent Technologies, Santa Clara, CA, USA).

5.7. In-Gel Tryptic Digestion

The gel band of interest in SDS-PAGE was cut carefully and placed in the Lo-Bind Eppendorf tube. Ammonium bicarbonate (ABC; 200 mM) in 40% of ACN was added to the tube and incubated at 37 °C for 30 min. The supernatant was later discarded, and 200 µL of 10 mM DTT reducing buffer was added to the tube and incubated for 1 h at 56 °C. Later, the reduction buffer was removed, and 55 mM of iodoacetamide alkylation buffer was added, and incubation was performed in the dark for 30 min. The alkylation buffer was removed, and the gel band was washed with 50 mM ABC followed by 50 mM ABC in 50% ACN at room temperature. The gel was washed three times in ACN for 15 min at 37 °C. The gel piece was briefly centrifuged, and all liquid was discarded before trypsin was added for digestion at 37 °C overnight. The supernatant containing the digested peptide was transferred to a new Lo-Bind Eppendorf tube and labelled collection tube. The digestion peptide collection continued with 5% formic acid (FA), followed by 50% ACN in 5% FA and ACN. Gel bands were incubated at 37 °C for 15 min, and all supernatant was transferred in the same collection tube. Recovered peptides were dried using a vacuum concentrator and stored at −80 °C before mass spectrometry analysis.

5.8. Protein Identification with Tandem Mass Spectrometry (ESI-LCMS/MS)

The in-gel digested sample was analyzed using the Agilent 1200 HPLC-Chip/MS Interface, coupled with Agilent 6550 iFunnel Q-TOF LC/MS. The digested peptides were loaded onto an Agilent C18 300 Å Large Capacity Chip (Agilent Technologies, Santa Clara, CA, USA). The column was equilibrated with 0.1% formic acid in water (solution A). Peptides were eluted with an increasing gradient of 90% acetonitrile (ACN) in 0.1% formic acid (solution B) by the following gradient: 5–75% solution B from 0 to 30 min and 75% solution B from 39 to 47 min. The polarity of the Q-TOF was set at positive, the capillary voltage at 1800 V, the fragmentor voltage at 360 V, the drying gas flow at 11 L/min, and a gas temperature of 280 °C. The spectrum was obtained from Agilent MassHunter Qualitative Analysis B.07.00 (Agilent Technologies, Santa Clara, CA, USA).

5.9. Automated De Novo Sequencing

Protein identification by automated de novo sequencing was conducted using PEAKS Studio X+ (version 10.0 Plus, Bioinformatics Solution, Waterloo, ON, Canada). The homology search was performed by comparing the de novo sequence tag with the SwissProt Serpentes database from September 2017. In PEAKS Studio X+, SPIDER mode was used. The setting for the false detection rate (FDR) is 0.1%, and a -log p score more than 20 for protein identification was accepted. Matched protein identification was accepted for protein coverage above 50%.

5.10. Molecular Modelling

The protein sequence obtained from SPIDER Mode from Peaks Studio X+ was used to identify structure homology using 3D structure tools in SwissModel. The template with similar coverage to A2-EPTX-Nsm1a and a high QMGE score (~1.0) based on its oligo state were selected for model building. A qualified model based on its QMEAN (Z score < 1) was finalized, and its PDB format was used to identify the disulphide bridge using Disulphide by Design 2.0 [85]. The structure was confirmed using other tools such as trRosetta and Phyton 3.7, as previously described. The disulfide bonds were confirmed using Dianna 1.1 [86] and CYSPRED [87].

5.11. PLA2 Activity

PLA2 activity of each fraction and A2-EPTX-Nsm1a was confirmed using the secretory PLA2 assay kit according to the manufacturer’s protocol (Catalogue No: 765001, Cayman Chemical, MI, USA). The final concentration of 0.45 μg/mL fractions was tested in the assay with a 1.66 mM substrate. Bee venom was used as the positive control. The activity of PLA2 was monitored for 30 min, and the absorbance was recorded every 3 min at 414 nm at 25 °C. The activity of PLA2 was calculated based on the manufacturer’s protocol.

5.12. PLA2 Inhibition by 4-Bromophenacyl Bromide (4-BPB) and EDTA

4-BPB was dissolved in acetone and mixed with 4.5 μg/mL of the A2-EPTX-Nsm1a sample to produce a final concentration of 1.8 mM 4-BPB, as in the previously described method [83]. The EDTA inhibition assay was incubated with 2 mM EDTA for 16 h at 25 °C. In this assay, the assay buffer was diluted, containing 1.66 mM substrate, 1 mM calcium chloride, 1 mM potassium chloride, and 0.03 mM Triton-X. Both conditions were measured at 414 nm at 25 °C for 30 min using an EON™ microplate spectrophotometer (BioTek Instruments, VT, USA). PLA2 activity of modified and treated A2-EPTX-Nsm1a was determined and compared with the enzyme without an inhibitor using a secretory PLA2 assay kit (Cayman Chemical, MI, USA).

5.13. Cell Culture

The human neuroblastoma cell line SH-SY5Y (ATCC CRL-2266) was seeded at a density of 20,000 cells/cm2 in T75 flasks. Cells were cryopreserved below passage 15 to avoid senescence. The culture was maintained in Dulbecco Modified Essential Medium (DMEM) High Glucose (Gibco 10569-010) supplemented with 10% heat-inactivated fetal bovine serum (FBS) (Gibco 10270) and 1X Antibiotic-Antimycotic (Gibco 15240-062) in humidified 5% CO2 and 37 °C incubators. The culture medium was replaced every two days until the culture reached confluency (70–80%) for sub-culturing or differentiation.

5.14. Cytotoxicity of A2-EPTX-Nsm1a on SH-SY5Y cells

Cytotoxicity of A2-EPTX-Nsm1a on the undifferentiated neuroblastoma cell line, SH-SY5Y, was assessed using thiazolyl blue tetrazolium bromide (Sigma-Aldrich Corp., St. Louis, MO, USA) in an MTT assay. Cells were seeded with a density of 10,000 cells/cm2 in 96 wells and maintained in growth media as described above until it reached 70–80% confluency. Different concentrations of A2-EPTX-Nsm1a and crude venom were added to each well and incubated for 24 h at 37 °C in a 5% CO2 humidified incubator. At the end of treatment, the MTT reagent was added until its final concentration was 0.05 mg/mL in each well. The cells were further incubated for 4 h at 37 °C and in a 5% CO2 humidified atmosphere. The insoluble formazan, which resulted from oxidation of the added MTT to vital cells, was dissolved by adding DMSO, and the absorbance of formazan was determined using an EON™ microplate spectrophotometer (BioTek Instruments, Winooski, Vermont, USA) at 570nm. The relative viability of the cells was defined as the ratio of optical density of formazan produced by cells treated with A2-EPTX-Nsm1a to the optical density produced by control cells. For each treatment, the optical density of control cells was considered as 100% of viable cells.

5.15. Statistical Analysis

Student’s t-test and a one-way ANOVA evaluated the statistical analysis for comparing two and three groups, respectively. Each experiment was conducted in at least three replicates, and the results were reported as the means ± standard deviations (SD). Differences were considered significant if p < 0.05.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/toxins13120859/s1, Figure S1: SDS-PAGE of protein bands from the fraction eluted in the G75 Superdex™ column named P1 and P2 (Figure 1b). Figure S2: Proteins bands of PLA2 fractions (APlTx-I and NPlTx-I) and APlTx-I accurate mass. Figure S3: PLA2 activity of all fractions. Table S1a: Protein profile of fraction P1 eluted from G75 Superdex™ column. Table S1b: Protein profile of fraction P2 eluted from G75 Superdex™ column. Table S2a: Protein profile of fraction NPlTx-I eluted from C18 reverse-phase column. Table S2b: Protein profile of fraction APlTx-I eluted from C18 reverse-phase column.

Author Contributions

Conceptualization, I.O.; Formal analysis, N.A.H.A.; Funding acquisition, I.O.; Investigation, N.A.H.A.; Methodology, N.A.H.A. and M.R.A.R.; Project administration, I.O.; Software, S.A.Z.A.; Supervision, M.R.A.R., M.F.S., W.C.H. and I.O.; Validation, M.R.A.R. and S.A.Z.A.; Visualization, N.A.H.A.; Writing–original draft, N.A.H.A.; Writing–review & editing, M.R.A.R., M.F.S., S.A.Z.A., W.C.H. and I.O. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by Monash University Malaysia GA21 grant (GA-HW-18-L02). M.R.A.R is a recipient of Fundamental Research Grant Scheme, Ministry of Higher Education (FRGS19-040-0648). W.C.H. is supported by an Australian National Health and Medical Research Council (NHMRC) Centres for Research Excellence Grant (ID: 1110343). The APC was funded by Jeffrey Cheah School of Medicine and Health Sciences, Monash University Malaysia and Faculty of Medicine, Universiti Kebangsaan Malaysia (UKM).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The data presented in this study are available in this article and supplementary materials.

Acknowledgments

We would like to thank Nurziana Sharmilla and Nasiha Musa for their technical support and Zainuddin Ismail for donating N. sumatrana venom from his private collection. We also thank Department of Wildlife and National Parks, Peninsular Malaysia for providing the research permit. N.A.H.A is a recipient of UKM SLAB scholarship from the Ministry of Higher Education, Government of Malaysia.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Das, I. Field Guide to the Reptiles of South-East Asia; Bloomsbury Publishing: London, UK, 2015; p. 384. [Google Scholar]
  2. Stuebing, R.B.; Inger, R.F.; Tan, F.L. Field Guide to the Snakes of Borneo; Natural History Publications (Borneo): Kota Kinabalu, Malaysia, 1999; p. 254. [Google Scholar]
  3. WHO. Guidelines for the Management of Snake Bites; Regional office for South-East Asia, World Health Organization: New Delhi, India, 2016. [Google Scholar]
  4. Ismail, A.K. Snakebite and envenomation management in Malaysia. Clin. Toxicol Asia Pac. Afr. 2015, 2, 71–102. [Google Scholar] [CrossRef]
  5. Yap, M.K.; Fung, S.Y.; Tan, K.Y.; Tan, N.H. Proteomic characterization of venom of the medically important Southeast Asian Naja sumatrana (Equatorial spitting cobra). Acta Trop. 2014, 133, 15–25. [Google Scholar] [CrossRef]
  6. Fry, B.G.; Scheib, H.; Van Der Weerd, L.; Young, B.; McNaughtan, J.; Ramjan, S.F.R.; Vidal, N.; Poelmann, R.E.; Norman, J.A. Evolution of an Arsenal: Structural and functional diversification of the venom system in the advanced snakes (Caenophidia). Mol. Cell. Proteom. 2008, 7, 215–246. [Google Scholar] [CrossRef] [Green Version]
  7. Petan, T.; Krizaj, I.; Pungercar, J. Restoration of enzymatic activity in a Ser-49 phospholipase A2 homologue decreases its Ca2+-independent membrane-damaging activity and increases its toxicity. Biochemistry 2007, 46, 12795–12809. [Google Scholar] [CrossRef]
  8. Murakami, T.; Kariu, T.; Takazaki, S.; Hattori, S.; Chijiwa, T.; Ohno, M.; Oda-Ueda, N. Island specific expression of a novel [Lys49] phospholipase A2 (BPIII) in Protobothrops flavoviridis venom in Amami–Oshima, Japan. Toxicon 2009, 54, 399–407. [Google Scholar] [CrossRef] [PubMed]
  9. Resende, L.M.; Almeida, J.R.; Schezaro-Ramos, R.; Collaço, R.C.O.; Simioni, L.R.; Ramírez, D.; González, W.; Soares, A.M.; Calderon, L.A.; Marangoni, S.; et al. Exploring and understanding the functional role, and biochemical and structural characteristics of an acidic phospholipase A2, AplTx-I, purified from Agkistrodon piscivorus leucostoma snake venom. Toxicon 2017, 127, 22–36. [Google Scholar] [CrossRef]
  10. Jiménez–Charris, E.; Lopes, D.; Gimenes, S.; Teixeira, S.C.; Montealegre–Sánchez, L.; Solano–Redondo, L.; Fierro–Pérez, L.; Ávila, V.D.M.R. Antitumor potential of Pllans–II, an acidic Asp49–PLA2 from Porthidium lansbergii lansbergii snake venom on human cervical carcinoma HeLa cells. Int. J. Biol. Macromol. 2019, 122, 1053–1061. [Google Scholar] [CrossRef] [PubMed]
  11. Salvador, G.H.; Cavalcante, W.L.; dos Santos, J.I.; Gallacci, M.; Soares, A.M.; Fontes, M.R. Structural and functional studies with mytoxin II from Bothrops moojeni reveal remarkable similarities and differences compared to other catalytically inactive phospholipases A2-like. Toxicon 2013, 72, 52–63. [Google Scholar] [CrossRef] [Green Version]
  12. Clement, H.; De Oliveira, V.C.; Zamudio, F.Z.; Lago, N.R.; Valdez-Cruz, N.A.; Valle, M.B.; Hajos, S.E.; Alagón, A.; Possani, L.D.; De Roodt, A.R. Isolation, amino acid sequence and biological characterization of an “aspartic-49” phospholipase A2 from Bothrops (Rhinocerophis) ammodytoides venom. Toxicon 2012, 60, 1314–1323. [Google Scholar] [CrossRef]
  13. Bustillo, S.; Gay, C.C.; Denegri, M.E.G.; Ponce-Soto, L.A.; Joffé, E.B.D.K.; Acosta, O.; Leiva, L.C. Synergism between baltergin metalloproteinase and Ba SPII RP4 PLA2 from Bothrops alternatus venom on skeletal muscle (C2C12) cells. Toxicon 2012, 59, 338–343. [Google Scholar] [CrossRef]
  14. Ullah, A.; Souza, T.; Betzel, C.; Murakami, M.; Arni, R. Crystallographic portrayal of different conformational states of a Lys49 phospholipase A2 homologue: Insights into structural determinants for myotoxicity and dimeric configuration. Int. J. Biol. Macromol. 2012, 51, 209–214. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  15. Huancahuire-Vega, S.; Ponce-Soto, L.A.; Martins-De-Souza, D.; Marangoni, S. Biochemical and pharmacological characterization of PhTX-I a new myotoxic phospholipase A2 isolated from Porthidium hyoprora snake venom. Comp. Biochem. Physiol. Part C Toxicol. Pharmacol. 2011, 154, 108–119. [Google Scholar] [CrossRef] [Green Version]
  16. Pereañez, J.A.; Núñez, V.; Huancahuire-Vega, S.; Marangoni, S.; Ponce-Soto, L.A. Biochemical and biological characterization of a PLA2 from crotoxin complex of Crotalus durissus cumanensis. Toxicon 2009, 53, 534–542. [Google Scholar] [CrossRef]
  17. Marques, P.P.; Esteves, A.; Lancellotti, M.; Ponce-Soto, L.A.; Marangoni, S. Novel acidic phospholipase A2 from Porthidium hyoprora causes inflammation with mast cell rich infiltrate. Biochem. Biophys. Rep. 2015, 1, 78–84. [Google Scholar] [CrossRef] [Green Version]
  18. Nunes, D.C.; Rodrigues, R.S.; Lucena, M.N.; Cologna, C.T.; Oliveira, A.C.S.; Hamaguchi, A.; Homsi-Brandeburgo, M.I.; Arantes, E.C.; Teixeira, D.N.; Ueira-Vieira, C.; et al. Isolation and functional characterization of proinflammatory acidic phospholipase A2 from Bothrops leucurus snake venom. Comp. Biochem. Physiol. Part C Toxicol. Pharmacol. 2011, 154, 226–233. [Google Scholar] [CrossRef] [PubMed]
  19. Toyama, D.d.O.; Diz Filho, E.B.d.S.; Cavada, B.S.; da Rocha, B.A.M.; de Oliveira, S.C.B.; Cotrim, C.A.; Soares, V.C.G.; Delatorre, P.; Marangoni, S.; Toyama, M.H. Umbelliferone induces changes in the structure and pharmacological activities of Bn IV, a phospholipase A2 isoform isolated from Bothrops neuwiedi. Toxicon 2011, 57, 851–860. [Google Scholar] [CrossRef] [PubMed]
  20. Wei, J.-F.; Wei, X.-L.; Mo, Y.-Z.; He, S.-H. Induction of microvascular leakage and histamine release by promutoxin, an Arg49 phospholipase A2. Toxicon 2010, 55, 888–896. [Google Scholar] [CrossRef]
  21. Toyama, D.; Marangoni, S.; Diz-Filho, E.; Oliveira, S.; Toyama, M. Effect of umbelliferone (7-hydroxycoumarin, 7-HOC) on the enzymatic, edematogenic and necrotic activities of secretory phospholipase A2 (sPLA2) isolated from Crotalus durissus collilineatus venom. Toxicon 2009, 53, 417–426. [Google Scholar] [CrossRef]
  22. de Carvalho, N.D.; Garcia, R.C.; Kleber Ferreira, A.; Rodrigo Batista, D.; Carlos Cassola, A.; Maria, D.; Lebrun, I.; Mendes Carneiro, S.; Castro Afeche, S.; Marcourakis, T.; et al. Neurotoxicity of coral snake phospholipases A2 in cultured rat hippocampal neurons. Brain Res. 2014, 1552, 1–16. [Google Scholar] [CrossRef]
  23. Vergara, I.; Pedraza-Escalona, M.; Paniagua, D.; Restano-Cassulini, R.; Zamudio, F.; Batista, C.V.F.; Possani, L.D.; Alagón, A. Eastern coral snake Micrurus fulvius venom toxicity in mice is mainly determined by neurotoxic phospholipases A2. J. Proteom. 2014, 105, 295–306. [Google Scholar] [CrossRef]
  24. Lomeo, R.D.S.; Gonçalves, A.P.D.F.; da Silva, C.N.; de Paula, A.T.; Santos, D.O.C.; Fortes-Dias, C.L.; Gomes, D.; de Lima, M.E. Crotoxin from Crotalus durissus terrificus snake venom induces the release of glutamate from cerebrocortical synaptosomes via N and P/Q calcium channels. Toxicon 2014, 85, 5–16. [Google Scholar] [CrossRef]
  25. Blacklow, B.; Escoubas, P.; Nicholson, G.M. Characterisation of the heterotrimeric presynaptic phospholipase A2 neurotoxin complex from the venom of the common death adder (Acanthophis antarcticus). Biochem. Pharmacol. 2010, 80, 277–287. [Google Scholar] [CrossRef] [Green Version]
  26. Menezes, T.N.; Naumann, G.B.; Peixoto, P.; Rouver, W.N.; Gomes, H.L.; Campos, F.V.; Borges, M.H.; dos Santos, R.L.; Bissoli, N.S.; Sanchez, E.F.; et al. Bothrops leucurus venom induces acute hypotension in rats by means of its phospholipase A2 (blD-PLA2). Toxicon 2020, 185, 5–14. [Google Scholar] [CrossRef] [PubMed]
  27. Zeng, F.; Zhang, W.; Xue, N.; Teng, M.; Li, X.; Shen, B. Crystal structure of phospholipase PA2-Vb, a protease-activated receptor agonist from the Trimeresurus stejnegeri snake venom. FEBS Lett. 2014, 588, 4604–4612. [Google Scholar] [CrossRef] [Green Version]
  28. Saikia, D.; Majumdar, S.; Mukherjee, A.K. Mechanism of in vivo anticoagulant and haemolytic activity by a neutral phospholipase A2 purified from Daboia russelii russelii venom: Correlation with clinical manifestations in Russell’s Viper envenomed patients. Toxicon 2013, 76, 291–300. [Google Scholar] [CrossRef]
  29. Marinho, A.D.; Silveira, J.A.M.; Chaves Filho, A.J.M.; Jorge, A.R.C.; Nogueira Junior, F.A.; Pereira, V.B.M.; de Aquino, P.E.A.; Pereira, C.A.S.; Evangelista, J.; Macedo, D.S.; et al. Bothrops pauloensis snake venom-derived Asp-49 and Lys-49 phospholipases A2 mediates acute kidney injury by oxidative stress and release of inflammatory cytokines. Toxicon 2021, 190, 31–38. [Google Scholar] [CrossRef] [PubMed]
  30. de Vasconcelos Azevedo, F.V.P.; Zóia, M.A.P.; Lopes, D.S.; Gimenes, S.N.; Vecchi, L.; Alves, P.T.; Rodrigues, R.S.; Silva, A.C.A.; Yoneyama, K.A.G.; Goulart, L.R.; et al. Antitumor and antimetastatic effects of PLA2-BthTX-II from Bothrops jararacussu venom on human breast cancer cells. Int. J. Biol. Macromol. 2019, 135, 261–273. [Google Scholar] [CrossRef]
  31. Silva, M.A.; Lopes, D.S.; Teixeira, S.C.; Gimenes, S.N.C.; Azevedo, F.V.P.V.; Polloni, L.; Borges, B.C.; da Silva, M.S.; Barbosa, M.J.; Oliveira Júnior, R.J.d.; et al. Genotoxic effects of BnSP-6, a Lys-49 phospholipase A2 (PLA2) homologue from Bothrops pauloensis snake venom, on MDA-MB-231 breast cancer cells. Int. J. Biol. Macromol. 2018, 118, 311–319. [Google Scholar] [CrossRef] [PubMed]
  32. Azevedo, F.V.P.V.; Lopes, D.S.; Cirilo Gimenes, S.N.; Achê, D.C.; Vecchi, L.; Alves, P.T.; Guimarães, D.d.O.; Rodrigues, R.S.; Goulart, L.R.; Rodrigues, V.d.M.; et al. Human breast cancer cell death induced by BnSP-6, a Lys-49 PLA2 homologue from Bothrops pauloensis venom. Int. J. Biol. Macromol. 2016, 82, 671–677. [Google Scholar] [CrossRef]
  33. Bazaa, A.; Luis, J.; Srairi-Abid, N.; Kallech-Ziri, O.; Kessentini-Zouari, R.; Defilles, C.; Lissitzky, J.-C.; El Ayeb, M.; Marrakchi, N. MVL-PLA2, a phospholipase A2 from Macrovipera lebetina transmediterranea venom, inhibits tumor cells adhesion and migration. Matrix Biol. 2009, 28, 188–193. [Google Scholar] [CrossRef]
  34. Zouari-Kessentini, R.; Luis, J.; Karray, A.; Kallech-Ziri, O.; Srairi-Abid, N.; Bazaa, A.; Loret, E.; Bezzine, S.; El Ayeb, M.; Marrakchi, N. Two purified and characterized phospholipases A2 from Cerastes cerastes venom, that inhibit cancerous cell adhesion and migration. Toxicon 2009, 53, 444–453. [Google Scholar] [CrossRef]
  35. Liu, W.-H.; Kao, P.-H.; Chiou, Y.-L.; Lin, S.-r.; Wu, M.-J.; Chang, L.-S. Catalytic activity-independent pathway is involved in phospholipase A2-induced apoptotic death of human leukemia U937 cells via Ca2+-mediated p38 MAPK activation and mitochondrial depolarization. Toxicol. Lett. 2009, 185, 102–109. [Google Scholar] [CrossRef] [PubMed]
  36. Polloni, L.; Azevedo, F.V.P.V.; Teixeira, S.C.; Moura, E.; Costa, T.R.; Gimenes, S.N.C.; Correia, L.I.V.; Freitas, V.; Yoneyama, K.A.G.; Rodrigues, R.S.; et al. Antiangiogenic effects of phospholipase A2 Lys49 BnSP-7 from Bothrops pauloensis snake venom on endothelial cells: An in vitro and ex vivo approach. Toxicol. Vitr. 2021, 72, 105099. [Google Scholar] [CrossRef]
  37. Santos-Filho, N.A.; de Freitas, L.M.; dos Santos, C.T.; Piccoli, J.P.; Fontana, C.R.; Fusco-Almeida, A.M.; Cilli, E.M. Understanding the mechanism of action of peptide (p-BthTX-I)2 derived from C-terminal region of phospholipase A2 (PLA2)-like bothropstoxin-I on Gram-positive and Gram-negative bacteria. Toxicon 2021, 196, 44–55. [Google Scholar] [CrossRef] [PubMed]
  38. Diz Filho, E.B.S.; Marangoni, S.; Toyama, D.O.; Fagundes, F.H.R.; Oliveira, S.C.B.; Fonseca, F.V.; Calgarotto, A.K.; Joazeiro, P.P.; Toyama, M.H. Enzymatic and structural characterization of new PLA2 isoform isolated from white venom of Crotalus durissus ruruima. Toxicon 2009, 53, 104–114. [Google Scholar] [CrossRef]
  39. de Barros, N.B.; Macedo, S.R.A.; Ferreira, A.S.; Tagliari, M.P.; Zanchi, F.B.; Kayano, A.M.; Soares, A.M.; Nicolete, R. Liposomes containing an ASP49-phospholipase A2 from Bothrops jararacussu snake venom as experimental therapy against cutaneous leishmaniasis. Int. Immunopharmacol. 2016, 36, 225–231. [Google Scholar] [CrossRef]
  40. Damico, D.C.S.; Vassequi-Silva, T.; Torres-Huaco, F.D.; Nery-Diez, A.C.C.; de Souza, R.C.G.; Da Silva, S.L.; Vicente, C.P.; Mendes, C.B.; Antunes, E.; Werneck, C.C.; et al. LmrTX, a basic PLA2 (D49) purified from Lachesis muta rhombeata snake venom with enzymatic-related antithrombotic and anticoagulant activity. Toxicon 2012, 60, 773–781. [Google Scholar] [CrossRef] [Green Version]
  41. Saikia, D.; Thakur, R.; Mukherjee, A.K. An acidic phospholipase A2 (RVVA-PLA2-I) purified from Daboia russelli venom exerts its anticoagulant activity by enzymatic hydrolysis of plasma phospholipids and by non-enzymatic inhibition of factor Xa in a phospholipids/Ca2+ independent manner. Toxicon 2011, 57, 841–850. [Google Scholar] [CrossRef]
  42. Muller, V.D.M.; Russo, R.R.; Oliveira Cintra, A.C.; Sartim, M.A.; De Melo Alves-Paiva, R.; Figueiredo, L.T.M.; Sampaio, S.V.; Aquino, V.H. Crotoxin and phospholipases A2 from Crotalus durissus terrificus showed antiviral activity against dengue and yellow fever viruses. Toxicon 2012, 59, 507–515. [Google Scholar] [CrossRef]
  43. da Silva Cunha, K.C.; Fuly, A.L.; Giestal de Araujo, E. A phospholipase A2 isolated from Lachesis muta snake venom increases the survival of retinal ganglion cells in vitro. Toxicon 2011, 57, 580–585. [Google Scholar] [CrossRef] [PubMed]
  44. Vija, H.; Samel, M.; Siigur, E.; Aaspõllu, A.; Trummal, K.; Tõnismägi, K.; Subbi, J.; Siigur, J. Purification, characterization, and cDNA cloning of acidic platelet aggregation inhibiting phospholipases A2 from the snake venom of Vipera lebetina (Levantine viper). Toxicon 2009, 54, 429–439. [Google Scholar] [CrossRef]
  45. Hiu, J.J.; Yap, M.K.K. Cytotoxicity of snake venom enzymatic toxins: Phospholipase A2 and l-amino acid oxidase. Biochem. Soc. Trans. 2020, 48, 719–731. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  46. Armugam, A.; Earnest, L.; Chung, M.C.; Gopalakrishnakone, P.; Tan, C.H.; Tan, N.H.; Jeyaseelan, K. Cloning and characterization of cDNAs encoding three isoforms of phospholipase A2 in Malayan spitting cobra (Naja naja sputatrix) venom. Toxicon 1997, 35, 27–37. [Google Scholar] [CrossRef]
  47. Jeyaseelan, K.; Armugam, A.; Donghui, M.; Tan, N.H. Structure and phylogeny of the venom group I phospholipase A2 gene. Mol. Biol. Evol. 2000, 17, 1010–1021. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  48. Miyoshi, S.-I.; Tu, A.T. Phospholipase A2 from Naja naja sputatrix venom is a muscarinic acetylcholine receptor inhibitor. Arch. Biochem. Biophys. 1996, 328, 17–25. [Google Scholar] [CrossRef] [PubMed]
  49. King, G.F.; Gentz, M.C.; Escoubas, P.; Nicholson, G.M. A rational nomenclature for naming peptide toxins from spiders and other venomous animals. Toxicon 2008, 52, 264–276. [Google Scholar] [CrossRef] [Green Version]
  50. Oliveira, J.S.; Fuentes-Silva, D.; King, G.F. Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon 2012, 60, 539–550. [Google Scholar] [CrossRef] [PubMed]
  51. Tan, K.Y.; Tan, C.H.; Chanhome, L.; Tan, N.H. Comparative venom gland transcriptomics of Naja kaouthia (monocled cobra) from Malaysia and Thailand: Elucidating geographical venom variation and insights into sequence novelty. PeerJ 2017, 5, e3142. [Google Scholar] [CrossRef] [Green Version]
  52. Chong, H.P.; Tan, K.Y.; Tan, N.H.; Tan, C.H. Exploring the Diversity and Novelty of Toxin Genes in Naja sumatrana, the Equatorial Spitting Cobra from Malaysia through De Novo Venom-Gland Transcriptomics. Toxins 2019, 11, 104. [Google Scholar] [CrossRef] [Green Version]
  53. Kazandjian, T.D.; Petras, D.; Robinson, S.D.; van Thiel, J.; Greene, H.W.; Arbuckle, K.; Barlow, A.; Carter, D.A.; Wouters, R.M.; Whiteley, G.; et al. Convergent evolution of pain-inducing defensive venom components in spitting cobras. Science 2021, 371, 386–390. [Google Scholar] [CrossRef]
  54. Serino-Silva, C.; Morais-Zani, K.; Hikari Toyama, M.; Toyama, D.O.; Gaeta, H.H.; Rodrigues, C.F.B.; Aguiar, W.D.S.; Tashima, A.K.; Grego, K.F.; Tanaka-Azevedo, A.M. Purification and characterization of the first γ-phospholipase inhibitor (γPLI) from Bothrops jararaca snake serum. PLoS ONE 2018, 13, e0193105. [Google Scholar] [CrossRef] [Green Version]
  55. Torres-Huaco, F.D.; Marunak, S.; Teibler, P.; Bustillo, S.; Acosta de Perez, O.; Leiva, L.C.; Ponce-Soto, L.A.; Marangoni, S. Local and systemic effects of BtaMP-1, a new weakly hemorrhagic snake venom metalloproteinase purified from Bothriopsis taeniata Snake Venom. Int. J. Biol. Macromol. 2019, 141, 1044–1054. [Google Scholar] [CrossRef]
  56. Vivas-Ruiz, D.E.; Gonzalez-Kozlova, E.E.; Delgadillo, J.; Palermo, P.M.; Sandoval, G.A.; Lazo, F.; Rodriguez, E.; Chavez-Olortegui, C.; Yarleque, A.; Sanchez, E.F. Biochemical and molecular characterization of the hyaluronidase from Bothrops atrox Peruvian snake venom. Biochimie 2019, 162, 33–45. [Google Scholar] [CrossRef]
  57. Rivas Mercado, E.; Neri Castro, E.; Benard Valle, M.; Rucavado-Romero, A.; Olvera Rodriguez, A.; Zamudio Zuniga, F.; Alagon Cano, A.; Garza Ocanas, L. Disintegrins extracted from totonacan rattlesnake (Crotalus totonacus) venom and their anti-adhesive and anti-migration effects on MDA-MB-231 and HMEC-1 cells. Toxicol. Vitr. 2020, 65, 104809. [Google Scholar] [CrossRef]
  58. Dennis, E.A. Diversity of group types, regulation, and function of phospholipase A2. J. Biol. Chem. 1994, 269, 13057–13060. [Google Scholar] [CrossRef]
  59. Dennis, E.A.; Cao, J.; Hsu, Y.H.; Magrioti, V.; Kokotos, G. Phospholipase A2 enzymes: Physical structure, biological function, disease implication, chemical inhibition, and therapeutic intervention. Chem. Rev. 2011, 111, 6130–6185. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  60. Vasquez, A.M.; Mouchlis, V.D.; Dennis, E.A. Review of four major distinct types of human phospholipase A2. Adv. Biol. Regul. 2018, 67, 212–218. [Google Scholar] [CrossRef]
  61. Filkin, S.Y.; Lipkin, A.V.; Fedorov, A.N. Phospholipase Superfamily: Structure, Functions, and Biotechnological Applications. Biochemistry 2020, 85, S177–S195. [Google Scholar] [CrossRef]
  62. Soares, A.M.; Giglio, J.R. Chemical modifications of phospholipases A2 from snake venoms: Effects on catalytic and pharmacological properties. Toxicon 2003, 42, 855–868. [Google Scholar] [CrossRef]
  63. Kudo, I.; Murakami, M. Phospholipase A2 enzymes. Prostaglandins Other Lipid Mediat. 2002, 68–69, 3–58. [Google Scholar] [CrossRef]
  64. Corasolla Carregari, V.; Stuani Floriano, R.; Rodrigues-Simioni, L.; Winck, F.V.; Baldasso, P.A.; Ponce-Soto, L.A.; Marangoni, S. Biochemical, pharmacological, and structural characterization of new basic PLA2 Bbil-TX from Bothriopsis bilineata snake venom. BioMed Res. Int. 2013, 2013, 612649. [Google Scholar] [CrossRef] [Green Version]
  65. van den Bergh, C.J.; Slotboom, A.J.; Verheij, H.M.; de Haas, G.H. The role of Asp-49 and other conserved amino acids in phospholipases A2 and their importance for enzymatic activity. J. Cell. Biochem. 1989, 39, 379–390. [Google Scholar] [CrossRef] [PubMed]
  66. Kramer, R.M.; Hession, C.; Johansen, B.; Hayes, G.; McGray, P.; Chow, E.P.; Tizard, R.; Pepinsky, R.B. Structure and properties of a human non-pancreatic phospholipase A2. J. Biol. Chem. 1989, 264, 5768–5775. [Google Scholar] [CrossRef]
  67. Tomoo, K.; Ohishi, H.; Doi, M.; Ishida, T.; Inoue, M.; Ikeda, K.; Mizuno, H. Interaction mode of n-dodecylphosphorylcholine, a substrate analogue, with bovine pancreas phospholipase A2 as determined by X-ray crystal analysis. Biochem. Biophys. Res. Commun. 1992, 187, 821–827. [Google Scholar] [CrossRef]
  68. Yap, M.K.; Tan, N.H.; Sim, S.M.; Fung, S.Y.; Tan, C.H. Pharmacokinetics of Naja sumatrana (equatorial spitting cobra) venom and its major toxins in experimentally envenomed rabbits. PLoS Negl. Trop. Dis. 2014, 8, e2890. [Google Scholar] [CrossRef] [PubMed]
  69. Shina, R.; Yates, S.L.; Ghassemi, A.; Rosenberg, P.; Condrea, E. Inhibitory effect of EDTA · Ca2+ on the hydrolysis of synaptosomal phospholipids by phospholipase A2 toxins and enzymes. Biochem. Pharmacol. 1990, 40, 2233–2239. [Google Scholar] [CrossRef]
  70. Huancahuire-Vega, S.; Ponce-Soto, L.A.; Marangoni, S. PhTX-II a basic myotoxic phospholipase A2 from Porthidium hyoprora snake venom, pharmacological characterization and amino acid sequence by mass spectrometry. Toxins 2014, 6, 3077–3097. [Google Scholar] [CrossRef] [Green Version]
  71. Rusmili, M.R.; Yee, T.T.; Mustafa, M.R.; Hodgson, W.C.; Othman, I. Isolation and characterization of a presynaptic neurotoxin, P-elapitoxin-Bf1a from Malaysian Bungarus fasciatus venom. Biochem. Pharmacol. 2014, 91, 409–416. [Google Scholar] [CrossRef]
  72. Fuly, A.L.; Calil-Elias, S.; Zingali, R.B.; Guimarães, J.A.; Melo, P.A. Myotoxic activity of an acidic phospholipase A2 isolated from Lachesis muta (Bushmaster) snake venom. Toxicon 2000, 38, 961–972. [Google Scholar] [CrossRef]
  73. Xicoy, H.; Wieringa, B.; Martens, G.J. The SH-SY5Y cell line in Parkinson’s disease research: A systematic review. Mol. Neurodegener. 2017, 12, 10. [Google Scholar] [CrossRef] [Green Version]
  74. Kovalevich, J.; Langford, D. Considerations for the use of SH-SY5Y neuroblastoma cells in neurobiology. Methods Mol. Biol. 2013, 1078, 9–21. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  75. Ross, R.A.; Spengler, B.A.; Biedler, J.L. Coordinate morphological and biochemical interconversion of human neuroblastoma cells. J. Natl. Cancer Inst. 1983, 71, 741–747. [Google Scholar] [CrossRef]
  76. Emanuelsson, I.; Norlin, M. Protective effects of 27- and 24-hydroxycholesterol against staurosporine-induced cell death in undifferentiated neuroblastoma SH-SY5Y cells. Neurosci. Lett. 2012, 525, 44–48. [Google Scholar] [CrossRef]
  77. Gill, I.; Kaur, S.; Kaur, N.; Dhiman, M.; Mantha, A.K. Phytochemical Ginkgolide B attenuates amyloid-β1-42 induced oxidative damage and altered cellular responses in human neuroblastoma SH-SY5Y cells. J. Alzheimers Dis. 2017, 60, S25–S40. [Google Scholar] [CrossRef] [PubMed]
  78. Jantas, D.; Greda, A.; Golda, S.; Korostynski, M.; Grygier, B.; Roman, A.; Pilc, A.; Lason, W. Neuroprotective effects of metabotropic glutamate receptor group II and III activators against MPP+-induced cell death in human neuroblastoma SH-SY5Y cells: The impact of cell differentiation state. Neuropharmacology 2014, 83, 36–53. [Google Scholar] [CrossRef] [PubMed]
  79. Maugeri, G.; D’Amico, A.G.; Rasà, D.M.; Saccone, S.; Federico, C.; Cavallaro, S.; D’Agata, V. PACAP and VIP regulate hypoxia-inducible factors in neuroblastoma cells exposed to hypoxia. Neuropeptides 2018, 69, 84–91. [Google Scholar] [CrossRef]
  80. Shipley, M.M.; Mangold, C.A.; Szpara, M.L. Differentiation of the SH-SY5Y human neuroblastoma cell line. J. Vis. Exp. 2016, 108, 53193. [Google Scholar] [CrossRef]
  81. Zhang, Y.; Anoopkumar-Dukie, S.; Mallik, S.B.; Davey, A.K. SIRT1 and SIRT2 modulators reduce LPS-induced inflammation in HAPI microglial cells and protect SH-SY5Y neuronal cells in vitro. J. Neural Transm. 2021, 128, 631–644. [Google Scholar] [CrossRef]
  82. Moreira, V.; Lomonte, B.; Vinolo, M.A.R.; Curi, R.; Gutiérrez, J.M.; Teixeira, C. An Asp49 phospholipase A2 snake venom induces cyclooxygenase-2 expression and prostaglandin E2 production via activation of NF-κB, p38MAPK, and PKC in macrophages. Mediat. Inflamm. 2014, 2014, 105879. [Google Scholar] [CrossRef] [Green Version]
  83. Bazaa, A.; Pasquier, E.; Defilles, C.; Limam, I.; Kessentini-Zouari, R.; Kallech-Ziri, O.; Battari, A.E.; Braguer, D.; Ayeb, M.E.; Marrakchi, N.; et al. MVL-PLA2, a snake venom phospholipase A2, inhibits angiogenesis through an increase in microtubule dynamics and disorganization of focal adhesions. PLoS ONE 2010, 5, e10124. [Google Scholar] [CrossRef] [Green Version]
  84. Manns, J.M. SDS-Polyacrylamide Gel Electrophoresis (SDS-PAGE) of proteins. Curr. Protoc. Microbiol. 2011, 22, A.3M.1–A.3M.13. [Google Scholar] [CrossRef]
  85. Craig, D.B.; Dombkowski, A.A. Disulfide by Design 2.0: A web-based tool for disulfide engineering in proteins. BMC Bioinform. 2013, 14, 1471–2105. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  86. Ferrè, F.; Clote, P. DiANNA: A web server for disulfide connectivity prediction. Nucleic Acids Res. 2005, 33, W230–W232. [Google Scholar] [CrossRef] [Green Version]
  87. Fariselli, P.; Riccobelli, P.; Casadio, R. Role of evolutionary information in predicting the disulfide-bonding state of cysteine in proteins. Proteins 1999, 36, 340–346. [Google Scholar] [CrossRef]
Figure 1. Sequential fractionation of A2-EPTX-Nsm1a from Malaysian Naja sumatrana venom. (a) Proteins with sequence similarity with PLA2 were identified in fraction 2 of Sephadex™ G50 by ESI-LC-MSMS. (b) Further fractionation using Superdex™ G75 separated the PLA2 from other proteins with similar protein mass and yielded two peaks (P1 and P2). (c) P1 was further fractionated with a reverse-phase column and separated into two PLA2 fractions (NPITx-I and APITx-I). (d) Isolated A2-EPTX-Nsm1a was detected in the peak indicated by * following additional reverse-phase chromatography.
Figure 1. Sequential fractionation of A2-EPTX-Nsm1a from Malaysian Naja sumatrana venom. (a) Proteins with sequence similarity with PLA2 were identified in fraction 2 of Sephadex™ G50 by ESI-LC-MSMS. (b) Further fractionation using Superdex™ G75 separated the PLA2 from other proteins with similar protein mass and yielded two peaks (P1 and P2). (c) P1 was further fractionated with a reverse-phase column and separated into two PLA2 fractions (NPITx-I and APITx-I). (d) Isolated A2-EPTX-Nsm1a was detected in the peak indicated by * following additional reverse-phase chromatography.
Toxins 13 00859 g001
Figure 2. Silver-stained SDS-PAGE (10% acrylamide gel) lanes loaded with marker and A2-EPTX-Nsm1a under non-reduced (lane 1) and reduced (lane 2) conditions. The MW of A2-EPTX-Nsm1a estimated from SDS-PAGE is 13.6 KDa.
Figure 2. Silver-stained SDS-PAGE (10% acrylamide gel) lanes loaded with marker and A2-EPTX-Nsm1a under non-reduced (lane 1) and reduced (lane 2) conditions. The MW of A2-EPTX-Nsm1a estimated from SDS-PAGE is 13.6 KDa.
Toxins 13 00859 g002
Figure 3. Intact protein mass analysis of Naja sumatrana A2-EPTX-Nsm1a by Agilent 6520 Accurate-Mass Q-TOF mass spectrometer. A dominant peak (*) indicated the molecular mass of A2-EPTX-Nsm1a.
Figure 3. Intact protein mass analysis of Naja sumatrana A2-EPTX-Nsm1a by Agilent 6520 Accurate-Mass Q-TOF mass spectrometer. A dominant peak (*) indicated the molecular mass of A2-EPTX-Nsm1a.
Toxins 13 00859 g003
Figure 4. Alignment of A2-EPTX-Nsm1a amino acid sequence with amino acid sequence of matched proteins from LC-MSMS analysis using Clustal Omega Multiple Alignment. Identified important regions and residues are shown in this diagram. * indicates identical amino acid present in A2-EPTX-Nsm1a and matched proteins.
Figure 4. Alignment of A2-EPTX-Nsm1a amino acid sequence with amino acid sequence of matched proteins from LC-MSMS analysis using Clustal Omega Multiple Alignment. Identified important regions and residues are shown in this diagram. * indicates identical amino acid present in A2-EPTX-Nsm1a and matched proteins.
Toxins 13 00859 g004
Figure 5. The theoretical structure of A2-EPTX-Nsm1a generated from SwissModel using SMTL ID: 1yxh.1, PLA2 from Naja naja sagittifera venom as the template (a). Homology molecular modelling cartoon indicates its secondary structure of α-helix and β-sheet structures (b) and the Ca2+ ligand (c). Cysteine residues present in the amino acid sequence of A2-EPTX-Nsm1a are highlighted in yellow (d). Prediction of disulfide link for A2-EPTX-Nsm1a using DiANNA 1.1 webserver showed 6 disulfide bridges and different disulfide link formations with the SMTL ID: 1yxh.1 template (e). These differences showed different interactions between the cysteine residues due to the absence of cysteine residues at the middle and C-terminal of the A2-EPTX-Nsm1a sequence (marked as #) (e).
Figure 5. The theoretical structure of A2-EPTX-Nsm1a generated from SwissModel using SMTL ID: 1yxh.1, PLA2 from Naja naja sagittifera venom as the template (a). Homology molecular modelling cartoon indicates its secondary structure of α-helix and β-sheet structures (b) and the Ca2+ ligand (c). Cysteine residues present in the amino acid sequence of A2-EPTX-Nsm1a are highlighted in yellow (d). Prediction of disulfide link for A2-EPTX-Nsm1a using DiANNA 1.1 webserver showed 6 disulfide bridges and different disulfide link formations with the SMTL ID: 1yxh.1 template (e). These differences showed different interactions between the cysteine residues due to the absence of cysteine residues at the middle and C-terminal of the A2-EPTX-Nsm1a sequence (marked as #) (e).
Toxins 13 00859 g005
Figure 6. Secretory PLA2 activity of A2-EPTX-Nsm1a and the crude venom of Naja sumatrana. A2-EPTX-Nsm1a activity in the (a) absence of chemical modification and in (b) the presence of 2 mM EDTA or (c) 1.8 mM 4BPB. Acetone, which was used to dissolve 4BPB, was used as a negative control (i.e., vehicle) in (c). The experiment was performed in triplicate. Data were statistically analyzed using t-test; **** indicated p < 0.001.
Figure 6. Secretory PLA2 activity of A2-EPTX-Nsm1a and the crude venom of Naja sumatrana. A2-EPTX-Nsm1a activity in the (a) absence of chemical modification and in (b) the presence of 2 mM EDTA or (c) 1.8 mM 4BPB. Acetone, which was used to dissolve 4BPB, was used as a negative control (i.e., vehicle) in (c). The experiment was performed in triplicate. Data were statistically analyzed using t-test; **** indicated p < 0.001.
Toxins 13 00859 g006
Figure 7. A2-EPTX-Nsm1a cytotoxicity against the neuroblastoma cell line, SH-SY5Y. (a) Concentration response of N. sumatrana crude venom and (b) secretory PLA2 isolated from N. sumatrana named A2-EPTX-Nsm1a. Cells were incubated with different concentrations of N. sumatarana crude venom and A2-EPTX-NSm1a for 24 h. MTT assay was performed to obtain the EC50 (concentration capable of reducing 50% of cell viability) curve (c) using Graph Pad Prism software. Cells without venom and A2-EPTX-NSm1a were used as control. Results were expressed as mean percentages (with control, considered 100%) ± SD (n = 5). * indicated p < 0.05, **** indicated p < 0.0001 compared to control.
Figure 7. A2-EPTX-Nsm1a cytotoxicity against the neuroblastoma cell line, SH-SY5Y. (a) Concentration response of N. sumatrana crude venom and (b) secretory PLA2 isolated from N. sumatrana named A2-EPTX-Nsm1a. Cells were incubated with different concentrations of N. sumatarana crude venom and A2-EPTX-NSm1a for 24 h. MTT assay was performed to obtain the EC50 (concentration capable of reducing 50% of cell viability) curve (c) using Graph Pad Prism software. Cells without venom and A2-EPTX-NSm1a were used as control. Results were expressed as mean percentages (with control, considered 100%) ± SD (n = 5). * indicated p < 0.05, **** indicated p < 0.0001 compared to control.
Toxins 13 00859 g007
Table 1. Sequence similarity of A2-EPTX-Nsm1a with other proteins from Serpentes database using Peaks Studio X+. Identity of A2-EPTX-Nsm1a identified in UniProt.
Table 1. Sequence similarity of A2-EPTX-Nsm1a with other proteins from Serpentes database using Peaks Studio X+. Identity of A2-EPTX-Nsm1a identified in UniProt.
Accession−10lgPCoverage (%)No. of PeptidesAverage MassDescriptionOriginIdentity (%)
Q92084233.5761716,189Neutral phospholipase A2 muscarinic inhibitorNaja sputatrix97.8
Q92085224.51721516,175Neutral phospholipase A2 BNaja sputatrix97.4
Q9I900200.54741216,097Acidic phospholipase A2 DNaja sputatrix94.9
Q92086198.43701116,082Acidic phospholipase A2 CNaja sputatrix94.9
P00596184.86641016,271Acidic phospholipase A2 1Naja kaouthia94
P00598179.5163816,013Acidic phospholipase A2 1Naja atra94
P00597179.5163816,016Acidic phospholipase A2 2Naja kaouthia94
Q91133179.0054715,949Acidic phospholipase A2 2Naja atra92.3
P15445172.3965713,346Acidic phospholipase A2 2 Naja naja92.3
A4FS04161.1377713,188Acidic phospholipase A2 natratoxin Naja atra92.3
Q6T179149.6651614,198Acidic phospholipase A2 4 (fragment)Naja sagittifera87.2
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Abdullah, N.A.H.; Rusmili, M.R.A.; Zainal Abidin, S.A.; Shaikh, M.F.; Hodgson, W.C.; Othman, I. Isolation and Characterization of A2-EPTX-Nsm1a, a Secretory Phospholipase A2 from Malaysian Spitting Cobra (Naja sumatrana) Venom. Toxins 2021, 13, 859. https://doi.org/10.3390/toxins13120859

AMA Style

Abdullah NAH, Rusmili MRA, Zainal Abidin SA, Shaikh MF, Hodgson WC, Othman I. Isolation and Characterization of A2-EPTX-Nsm1a, a Secretory Phospholipase A2 from Malaysian Spitting Cobra (Naja sumatrana) Venom. Toxins. 2021; 13(12):859. https://doi.org/10.3390/toxins13120859

Chicago/Turabian Style

Abdullah, Nur Atiqah Haizum, Muhamad Rusdi Ahmad Rusmili, Syafiq Asnawi Zainal Abidin, Mohd Farooq Shaikh, Wayne C. Hodgson, and Iekhsan Othman. 2021. "Isolation and Characterization of A2-EPTX-Nsm1a, a Secretory Phospholipase A2 from Malaysian Spitting Cobra (Naja sumatrana) Venom" Toxins 13, no. 12: 859. https://doi.org/10.3390/toxins13120859

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop