Revisiting the Non-Coding Nature of Pospiviroids
Abstract
:1. Introduction
2. Materials and Methods
2.1. Bioinformatic Analysis
2.2. Plants and Infections
2.3. Total Ribosome Isolation, Polysome Fractionation and RNA Preparation
2.4. High Throughput Sequencing for Detection of Quasi-Species
2.5. cDNA Synthesis, RT-PCR, RT-qPCR and Northern Blot for PSTVd Detection
2.6. In Vitro Translation and Immunoblot Assays
2.7. Proteomic Analysis
3. Results
3.1. Analysis of the Presence of ORFs in Viroid Sequences
3.2. Analysis of Potential Quasi-Species during Infections to Identify Possible Additional ORFs
3.3. The Circular Form of PSTVd Is Associated with Ribosomes
3.4. In Vitro Translation of PSTVd
3.5. Using Mass Spectrometry to Identify PSTVd Produced Small Peptides
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Parsyan, A. Translation and Its Regulation in Cancer Biology and Medicine; Springer Publishing: Cham, Switzerland, 2014. [Google Scholar]
- Kearse, M.G.; Wilusz, J.E. Non-AUG translation: A new start for protein synthesis in eukaryotes. Genes Dev. 2017, 31, 1717–1731. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wu, J.; Xiao, J.; Zhang, Z.; Wang, X.; Hu, S.; Yu, J. Ribogenomics: The Science and Knowledge of RNA. Genom. Proteom. Bioinform. 2014, 12, 57–63. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Katsarou, K.; Rao, A.; Tsagris, M.; Kalantidis, K. Infectious long non-coding RNAs. Biochime 2015, 117, 37–47. [Google Scholar] [CrossRef] [PubMed]
- Hsu, M.-T.; Coca-Prados, M. Electron microscopic evidence for the circular form of RNA in the cytoplasm of eukaryotic cells. Nature 1979, 280, 339–340. [Google Scholar] [CrossRef]
- Chen, L.-L.; Yang, L. Regulation of circRNA biogenesis. RNA Biol. 2015, 12, 381–388. [Google Scholar] [CrossRef]
- Chen, L.-L. The expanding regulatory mechanisms and cellular functions of circular RNAs. Nat. Rev. Mol. Cell Biol. 2020, 21, 475–490. [Google Scholar] [CrossRef]
- Wang, Y.; Wang, Z. Efficient backsplicing produces translatable circular mRNAs. RNA 2014, 21, 172–179. [Google Scholar] [CrossRef] [Green Version]
- Legnini, I.; Di Timoteo, G.; Rossi, F.; Morlando, M.; Briganti, F.; Sthandier, O.; Fatica, A.; Santini, T.; Andronache, A.; Wade, M.; et al. Circ-ZNF609 Is a Circular RNA that Can Be Translated and Functions in Myogenesis. Mol. Cell 2017, 66, 22–37.e9. [Google Scholar] [CrossRef] [Green Version]
- Pamudurti, N.R.; Bartok, O.; Jens, M.; Ashwal-Fluss, R.; Stottmeister, C.; Ruhe, L.; Hanan, M.; Wyler, E.; Perez-Hernandez, D.; Ramberger, E.; et al. Translation of CircRNAs. Mol. Cell 2017, 66, 9–21.e7. [Google Scholar] [CrossRef] [Green Version]
- Yang, Y.; Fan, X.; Mao, M.; Song, X.; Wu, P.; Zhang, Y.; Jin, Y.; Yang, Y.; Chen, L.-L.; Wang, Y.; et al. Extensive translation of circular RNAs driven by N6-methyladenosine. Cell Res. 2017, 27, 626–641. [Google Scholar] [CrossRef] [Green Version]
- Fan, X.; Yang, Y.; Wang, Z. Pervasive translation of circular RNAs driven by short IRES-like elements. bioRxiv 2020, 473207. [Google Scholar] [CrossRef] [Green Version]
- Heesch, V.S.; Witte, F.; Schneider-Lunitz, V.; Schulz, J.F.; Adami, E.; Faber, A.B.; Kirchner, M.; Maatz, H.; Blachut, S.; Sandmann, C.-L.; et al. The Translational Landscape of the Human Heart. Cell 2019, 178, 242–260.e29. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sogo, J.; Koller, T.; Diener, T. Potato spindle tuber viroid. Virology 1973, 55, 70–80. [Google Scholar] [CrossRef]
- Flores, R.; Di Serio, F.; Navarro, B.; Duran-Vila, N.; Owens, R. Viroids and viroid diseases of plants. Wiley Blackwell 2011, 12, 307–341. [Google Scholar]
- Diener, T.O. Potato spindle tuber “virus”. Virology 1971, 45, 411–428. [Google Scholar] [CrossRef]
- Di Serio, F.; Flores, R.; Verhoeven, K.; Li, S.; Pallas, V.; Randles, J.; Sano, T.; Vidalakis, G.; Owens, R.A. Current status of viroid taxonomy. Arch. Virol. 2014, 159, 3467–3478. [Google Scholar] [CrossRef] [PubMed]
- Rao, A.; Kalantidis, K. Virus-associated small satellite RNAs and viroids display similarities in their replication strategies. Virology 2015, 479, 627–636. [Google Scholar] [CrossRef] [Green Version]
- Steger, G.; Perreault, J.-P. Structure and Associated Biological Functions of Viroids; Elsevier: Amsterdam, The Netherlands, 2016; Volume 94, pp. 141–172. [Google Scholar]
- Adkar-Purushothama, C.R.; Perreault, J. Current overview on viroid–host interactions. Wiley Interdiscip. Rev. RNA 2020, 11, e1570. [Google Scholar] [CrossRef] [PubMed]
- AbouHaidar, M.G.; Venkataraman, S.; Golshani, A.; Liu, B.; Ahmad, T. Novel coding, translation, and gene expression of a replicating covalently closed circular RNA of 220 nt. Proc. Natl. Acad. Sci. USA 2014, 111, 14542–14547. [Google Scholar] [CrossRef] [Green Version]
- Davies, J.; Kaesberg, P.; Diener, T. Potato spindle tuber viroid. XII. An investigation of viroid RNA as a messenger for protein synthesis. Virology 1974, 61, 281–286. [Google Scholar] [CrossRef]
- Hall, T.C. Functional Citrus Distinctions Viroid between the Ribonucleic Reactions Acids from Translation Exocortis and Plant Viruses: And Aminoacylation. Virology 1974, 492, 486–492. [Google Scholar] [CrossRef]
- Conejero, V.; Semancik, J. Exocortis viroid: Alteration in the proteins of Gynura aurantiaca accompanying viroid infection. Virology 1977, 77, 221–232. [Google Scholar] [CrossRef]
- Zaitlin, M.; Hariharasubramanian, V. A gel electrophoretic analysis of proteins from plants infected with tobacco mosaic and potato spindle tuber viruses. Virology 1972, 47, 296–305. [Google Scholar] [CrossRef]
- Semancik, J.; Conejero, V.; Gerhart, J. Citrus exocortis viroid: Survey of protein synthesis in Xenopus laevis oocytes following addition of viroid RNA. Virology 1977, 80, 218–221. [Google Scholar] [CrossRef]
- Cottilli, P.; Belda-Palazon, B.; Adkar-Purushothama, C.R.; Perreault, J.-P.; Schleiff, E.; Rodrigo, I.; Ferrando, A.; Lisón, P. Citrus exocortis viroid causes ribosomal stress in tomato plants. Nucleic Acids Res. 2019, 47, 8649–8661. [Google Scholar] [CrossRef]
- Lisón, P.; Tárraga, S.; López-Gresa, P.; Saurí, A.; Torres, C.; Campos, L.; Bellés, J.M.; Conejero, V.; Rodrigo, I. A noncoding plant pathogen provokes both transcriptional and posttranscriptional alterations in tomato. Proteomics 2013, 13, 833–844. [Google Scholar] [CrossRef]
- Dubé, A.; Bisaillon, M.; Perreault, J.-P. Identification of Proteins from Prunus persica That Interact with Peach Latent Mosaic Viroid. J. Virol. 2009, 83, 12057–12067. [Google Scholar] [CrossRef] [Green Version]
- Marquez-Molins, J.; Navarro, J.A.; Seco, L.C.; Pallas, V.; Gomez, G. Might exogenous circular RNAs act as protein-coding transcripts in plants? RNA Biol. 2021, 18, 98–107. [Google Scholar] [CrossRef]
- Quinlan, A.R.; Hall, I.M. BEDTools: A flexible suite of utilities for comparing genomic features. Bioinformatics 2010, 26, 841–842. [Google Scholar] [CrossRef] [Green Version]
- Kazutaka, K.; Misakwa, K.; Kei-ichi, K.; Miyata, T. MAFFT: A novel method for rapid multiple sequence alignment based on fast Fourier transform. Nucleic Acids Res. 2002, 30, 3059–3066. [Google Scholar] [CrossRef] [Green Version]
- Joshi, C.P.; Zhou, H.; Huang, X.; Chiang, V.L. Context sequences of translation initiation codon in plants. Plant Mol. Biol. 1997, 35, 993–1001. [Google Scholar] [CrossRef]
- Adkar-Purushothama, C.R.; Brosseau, C.; Giguère, T.; Sano, T.; Moffett, P.; Perreault, J.-P. Small RNA Derived from the Virulence Modulating Region of the Potato spindle tuber viroid Silences callose synthase Genes of Tomato Plants. Plant Cell 2015, 27, 2178–2194. [Google Scholar] [CrossRef] [Green Version]
- Adkar-Purushothama, C.R.; Perreault, J.-P. Alterations of the viroid regions that interact with the host defense genes attenuate viroid infection in host plant. RNA Biol. 2018, 15, 955–966. [Google Scholar] [CrossRef] [PubMed]
- Katsarou, K.; Mavrothalassiti, E.; Dermauw, W.; Van Leeuwen, T.; Kalantidis, K. Combined Activity of DCL2 and DCL3 Is Crucial in the Defense against Potato Spindle Tuber Viroid. PLoS Pathog. 2016, 12, e1005936. [Google Scholar] [CrossRef] [PubMed]
- Rivera, M.C.; Maguire, B.; Lake, J.A. Purification of Polysomes. Cold Spring Harb. Protoc. 2015, 2015, 303–305. [Google Scholar] [CrossRef] [PubMed]
- Parenteau, J.; Lavoie, M.; Catala, M.; Malik-Ghulam, M.; Gagnon, J.; Elela, S.A. Preservation of Gene Duplication Increases the Regulatory Spectrum of Ribosomal Protein Genes and Enhances Growth under Stress. Cell Rep. 2015, 13, 2516–2526. [Google Scholar] [CrossRef] [Green Version]
- Adkar-Purushothama, C.R.; Iyer, P.S.; Perreault, J.-P. Potato spindle tuber viroid infection triggers degradation of chloride channel protein CLC-b-like and Ribosomal protein S3a-like mRNAs in tomato plants. Sci. Rep. 2017, 7, 8341. [Google Scholar] [CrossRef] [Green Version]
- Dadami, E.; Boutla, A.; Vrettos, N.; Tzortzakaki, S.; Karakasilioti, I.; Kalantidis, K. DICER-LIKE 4 But Not DICER-LIKE 2 May Have a Positive Effect on Potato Spindle Tuber Viroid Accumulation in Nicotiana benthamiana. Mol. Plant 2013, 6, 232–234. [Google Scholar] [CrossRef] [Green Version]
- Chen, S.; Zhou, Y.; Chen, Y.; Gu, J. fastp: An ultra-fast all-in-one FASTQ preprocessor. Bioinformatics 2018, 34, i884–i890. [Google Scholar] [CrossRef]
- OFFICIAL STATEMENT. BMJ 1854, s3-2, 68–70. [CrossRef] [Green Version]
- Li, H.; Handsaker, B.; Wysoker, A.; Fennell, T.; Ruan, J.; Homer, N.; Marth, G.; Abecasis, G.; Durbin, R.; 1000 Genome Project Data Processing Subgroup. The Sequence Alignment/Map format and SAMtools. Bioinformatics 2009, 25, 2078–2079. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Marinier, E.; Enns, E.; Tran, C.; Fogel, M.; Peters, C.; Kidwai, A.; Ji, H.; Van Domselaar, G. Quasitools: A Collection of Tools for Viral Quasispecies Analysis. bioRxiv 2019, 1–4. [Google Scholar] [CrossRef] [Green Version]
- Verhoeven, K.; Jansen, C.; Willemen, T.; Kox, L.; Owens, R.; Roenhorst, J. Natural infections of tomato by Citrus exocortis viroid, Columnea latent viroid, Potato spindle tuber viroid and Tomato chlorotic dwarf viroid. Eur. J. Plant Pathol. 2004, 110, 823–831. [Google Scholar] [CrossRef]
- Boonham, N.; González-Pérez, L.; Mendez, M.; Peralta, E.; Blockley, A.; Walsh, K.; Barker, I.; Mumford, R. Development of a real-time RT-PCR assay for the detection of Potato spindle tuber viroid. J. Virol. Methods 2004, 116, 139–146. [Google Scholar] [CrossRef] [PubMed]
- Hellemans, J.; Mortier, G.; De Paepe, A.; Speleman, F.; Vandesompele, J. qBase relative quantification framework and software for management and automated analysis of real-time quantitative PCR data. Genome Biol. 2007, 8, R19. [Google Scholar] [CrossRef] [Green Version]
- Hughes, C.S.; Foehr, S.; Garfield, A.D.; Furlong, E.; Steinmetz, L.; Krijgsveld, J. Ultrasensitive proteome analysis using paramagnetic bead technology. Mol. Syst. Biol. 2014, 10, 757. [Google Scholar] [CrossRef]
- Candiano, G.; Bruschi, M.; Musante, L.; Santucci, L.; Ghiggeri, G.M.; Carnemolla, B.; Orecchia, P.; Zardi, L.; Righetti, P.G. Blue silver: A very sensitive colloidal Coomassie G-250 staining for proteome analysis. Electrophor. 2004, 25, 1327–1333. [Google Scholar] [CrossRef]
- Shevchenko, A.; Tomas, H.; Havlis, J.; Olsen, J.; Mann, M.J. In-gel digestion for mass spectrometric characterization of proteins and proteomes. Nat. Protoc. 2006, 1, 2856–2860. [Google Scholar] [CrossRef]
- Cox, J.; Mann, M. MaxQuant enables high peptide identification rates, individualized p.p.b.-range mass accuracies and proteome-wide protein quantification. Nat. Biotechnol. 2008, 26, 1367–1372. [Google Scholar] [CrossRef]
- Tyanova, S.; Temu, T.; Sinitcyn, P.; Carlson, A.; Hein, M.Y.; Geiger, T.; Mann, M.; Cox, J. The Perseus computational platform for comprehensive analysis of (prote)omics data. Nat. Methods 2016, 13, 731–740. [Google Scholar] [CrossRef]
- Tian, F.; Yang, D.-C.; Meng, Y.-Q.; Jin, J.; Gao, G. PlantRegMap: Charting functional regulatory maps in plants. Nucleic Acids Res. 2019, 48, D1104–D1113. [Google Scholar] [CrossRef] [PubMed]
- Kozak, M. Context effects and inefficient initiation at non-AUG codons in eucaryotic cell-free translation systems. Mol. Cell. Biol. 1989, 9, 5073–5080. [Google Scholar] [CrossRef]
- Keese, P.; Symons, R.H. Domains in viroids: Evidence of intermolecular RNA rearrangements and their contribution to viroid evolution. Proc. Natl. Acad. Sci. USA 1985, 82, 4582–4586. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhong, X.; Archual, A.J.; Amin, A.A.; Ding, B. A Genomic Map of Viroid RNA Motifs Critical for Replication and Systemic Trafficking. Plant. Cell. 2008, 20, 35–47. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Nagy, P.D. Recombination in plant RNA viruses. In Plant Virus Evolution; Roossinck, M.J., Ed.; Springer: Berlin/Heidelberg, Germany, 2008; pp. 133–156. ISBN 978-3-540-75762-7. [Google Scholar]
- Giguère, T.; Adkar-Purushothama, C.R.; Perreault, J.-P. Comprehensive Secondary Structure Elucidation of Four Genera of the Family Pospiviroidae. PLoS ONE 2014, 9, e98655. [Google Scholar] [CrossRef]
- Giguère, T.; Perreault, J.-P. Classification of the Pospiviroidae based on their structural hallmarks. PLoS ONE 2017, 12, e0182536. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- López-Carrasco, A.; Ballesteros, C.; Sentandreu, V.; Delgado, S.; Zachert, S.G.; Flores, R.; Sanjuán, R. Different rates of spontaneous mutation of chloroplastic and nuclear viroids as determined by high-fidelity ultra-deep sequencing. PLoS Pathog. 2017, 13, e1006547. [Google Scholar] [CrossRef] [PubMed]
- Kalantidis, K.; Denti, M.A.; Tzortzakaki, S.; Marinou, E.; Tabler, M.; Tsagris, M. Virp1 Is a Host Protein with a Major Role in Potato Spindle Tuber Viroid Infection in Nicotiana Plants. J. Virol. 2007, 81, 12872–12880. [Google Scholar] [CrossRef] [Green Version]
- Hill, J.M.; Ezhao, Y.; Ebhattacharjee, S.; Lukiw, W.J. miRNAs and viroids utilize common strategies in genetic signal transfer. Front. Mol. Neurosci. 2014, 7, 10. [Google Scholar] [CrossRef] [Green Version]
- Lauressergues, D.; Couzigou, J.-M.; Clemente, H.S.; Martinez, Y.; Dunand, C.; Bécard, G.; Combier, J.-P. Primary transcripts of microRNAs encode regulatory peptides. Nature 2015, 520, 90–93. [Google Scholar] [CrossRef] [PubMed]
- Yadav, A.; Sanyal, I.; Rai, S.P.; Lata, C. An overview on miRNA-encoded peptides in plant biology research. Genomics 2021, 113, 2385–2391. [Google Scholar] [CrossRef] [PubMed]
- Hellens, R.P.; Brown, C.; Chisnall, M.A.; Waterhouse, P.M.; Macknight, R.C. The Emerging World of Small ORFs. Trends Plant. Sci. 2016, 21, 317–328. [Google Scholar] [CrossRef] [PubMed]
- Schepetilnikov, M.; Schott, G.; Katsarou, K.; Thiébeauld, O.; Keller, M.; Ryabova, L.A. Molecular dissection of the prototype foamy virus (PFV) RNA 5′-UTR identifies essential elements of a ribosomal shunt. Nucleic Acids Res. 2009, 37, 5838–5847. [Google Scholar] [CrossRef] [PubMed]
- González, M.D.L.L.G.; Rodríguez-Kessler, M.; Jiménez-Bremont, J.F. uORF, a regulatory mechanism of the Arabidopsis polyamine oxidase 2. Mol. Biol. Rep. 2014, 41, 2427–2443. [Google Scholar] [CrossRef] [PubMed]
- Zemella, A.; Thoring, L.; Hoffmeister, C.; Kubick, S. Cell-Free Protein Synthesis: Pros and Cons of Prokaryotic and Eukaryotic Systems. ChemBioChem 2015, 16, 2420. [Google Scholar] [CrossRef] [Green Version]
- Walsh, D.; Mathews, M.B.; Mohr, I. Tinkering with Translation: Protein Synthesis in Virus-Infected Cells. Cold Spring Harb. Perspect. Biol. 2013, 5, a012351. [Google Scholar] [CrossRef]
- Wang, S.; Tian, L.; Liu, H.; Li, X.; Zhang, J.; Chen, X.; Jia, X.; Zheng, X.; Wu, S.; Chen, Y.; et al. Large-Scale Discovery of Non-conventional Peptides in Maize and Arabidopsis through an Integrated Peptidogenomic Pipeline. Mol. Plant. 2020, 13, 1078–1093. [Google Scholar] [CrossRef] [PubMed]
- Castles, J.J.; Singer, M.F. Degradation of polyuridylic acid by ribonuclease II: Protection by ribosomes. J. Mol. Biol. 1969, 40, 1–17. [Google Scholar] [CrossRef]
- Wolin, S.L.; Walter, P. Ribosome pausing and stacking during translation of a eukaryotic mRNA. EMBO J. 1988, 7, 3559–3569. [Google Scholar] [CrossRef]
- Noma, K.; Goncharov, A.; Ellisman, M.H.; Jin, Y. Microtubule-dependent ribosome localization in C. elegans neurons. ELife 2017, 6, 1–23. [Google Scholar] [CrossRef]
- Perez-Riverol, Y.; Csordas, A.; Bai, J.; Bernal-Llinares, M.; Hewapathirana, S.; Kundu, D.J.; Inuganti, A.; Griss, J.; Mayer, G.; Eisenacher, M.; et al. The pride database and related tools and resources in 2019: Improving support for quantification data. Nucleic Acids Res. 2019, 47, 442–450. [Google Scholar] [CrossRef] [PubMed]
Viroids | Abbreviations | Number of Different Peptides | Mean of Peptides Molecular Weight (Da) | Deviation of Peptides Molecular Weight (Da) | Mean Number of Nucleotides | Deviation of Number of Nucleotides |
---|---|---|---|---|---|---|
Apple Dimple viroid | ADFVd | 112 | 4,985,472 | 3,839,693 | 124,488 | 92,301 |
Apple Scar Skin viroid | ASSVd | 403 | 5,357,067 | 3,545,363 | 13,651 | 87,982 |
Australian Grapevine viroid | AGVd | 385 | 5,797,681 | 3,301,071 | 146,785 | 82,668 |
Chrysanthemum Stunt viroid | CSVd | 391 | 5,696,392 | 3,064,454 | 138,372 | 71,622 |
Citrus Bark Cracking viroid | CBCVd | 109 | 5,614,057 | 3,736,423 | 139,106 | 89,363 |
Citrus Bent leaf viroid | CBLVd | 197 | 4,559,265 | 3,222,127 | 118,054 | 8299 |
Citrus Dwarfing viroid | CDVd | 317 | 4,235,954 | 2,457,568 | 1,043,122 | 57,357 |
Citrus Exocortis viroid | CEVd | 717 | 8,908,622 | 414,267 | 22,654 | 103,926 |
Citrus viroid V | CVd-V | 79 | 4,790,307 | 3,350,296 | 123 | 83,618 |
Citrus viroid VI | CVd-VI | 80 | 4,946,414 | 3,800,323 | 122,963 | 92,295 |
Coconut cadang-cadang viroid | CCCVd | 27 | 848,874 | 4,918,339 | 209,777 | 116,172 |
Columnea Latent viroid | CBVd1 | 290 | 7,315,868 | 5,184,612 | 187,693 | 134,273 |
Coleus Blumei viroid 1 | CBVd2 | 26 | 5,725,483 | 295,522 | 144,387 | 71,306 |
Coleus Blumei viroid 2 | CBVd3 | 14 | 14,849,266 | 4,436,371 | 376 | 133,152 |
Coleus Blumei viroid 3 | CBVd5 | 12 | 5,500,916 | 4,175,932 | 13,475 | 101,042 |
Coleus Blumei viroid 5 | CBVd6 | 12 | 76,025 | 3,621,197 | 196,285 | 93,803 |
Coleus Blumei viroid 6 | CLVd | 7 | 11,385,714 | 8,186,838 | 287,571 | 208,934 |
Dahlia Latent viroid | DLVd | 10 | 3024 | 2,759,504 | 78 | 71,233 |
Grapevine Yellow Speckle viroid 1 | GYSVd1 | 404 | 70,593 | 381,389 | 177,653 | 94,235 |
Grapevine Yellow Speckle viroid 2 | GYSVd2 | 202 | 9564 | 501,981 | 236,137 | 121,745 |
Hop Latent viroid | HLVd | 48 | 6,968,053 | 4,348,142 | 175,553 | 110,481 |
Hop stunt viroid | HSVd | 1187 | 797,481 | 5,295,964 | 19,715 | 129,347 |
Iresine viroid 1 | IrVd | 36 | 8,082,925 | 4,206,529 | 20,985 | 10,268 |
Mexican Papita viroid | MPVd | 40 | 9,292,166 | 4,819,751 | 229,214 | 116,252 |
Pear Blister Canker viroid | PBCVd | 199 | 442,312 | 303,035 | 11,375 | 76,997 |
Pepper Chat Fruit viroid | PCFVd | 133 | 85,162,875 | 443,507 | 2135 | 108,787 |
Persimmon viroid 2 | PVd | 8 | 405,225 | 2,535,428 | 1035 | 6605 |
Potato Spindle Tuber viroid | PSTVd | 612 | 10,691,688 | 6,520,371 | 269,441 | 16,247 |
Tomato Apical Stunt viroid | TASVd | 102 | 684,758 | 408,641 | 16,863 | 1001 |
Tomato Chlorotic Dwarf viroid | TCDVd | 56 | 5943 | 470,731 | 14,877 | 117,745 |
Viroid. | Number of Isolates |
---|---|
PSTVd | 17 |
CEVd | 1 |
CSVd | 8 |
CLVd | 1 |
Start Site | Stop Site | Amino Sequence | Length | Molecular Weight |
---|---|---|---|---|
33 | 42 | LTSSTOP | 3 | 355 |
51 | 156 | KKKEGGSEERFRDPRGNLERTGKKGRWGVPSGRQESTOP | 35 | 4621 |
58 | 311 | KKAARRSASGIPGETWSELAKKDGGECPAADRSNSRRNRVFTLPFFGFPSSRPQDHPSPPLRCRFGYYPVETTEAPENRFFSILLAPGRGCLALGTAVGSSELNSWFLWFTPDLLTRKEKRRRLGGALQGSPGKPGANWQKRTVGSAQRPTGVIPAETGFSPFLSSGFLPRARRTTPRPLCAVASAITRWKQLKLPRTAFSLSYSTOP | 204 | 24,375 |
243 | 276 | LSLRLLPGGNNSTOP | 11 | 1332 |
324 | 34 | RVFSPWNRSWFLGTKLVVPVVHTSTOP | 23 | 3119 |
338 | 6 | LEPQLVPRNSTOP | 9 | 1208 |
C: Human-Readable-Description | ||
---|---|---|
Sol Genomics | Benth Genome | Log2 Difference (Infected Samples-Control Samples) |
Signaling | ||
Protein phosphatase 2C family protein | Probable protein phosphatase 2C 55 | −1.3518609 |
Peroxiredoxin-2B | Peroxiredoxin-2B (probable),thioredoxin peroxidase 1 | 0.4045086 |
SIT4 ph isoform 1 [Theobroma cacao];SIT4 phosphatase-associated family protein SIT4 phosphatase-associated family protein | serine threonine-protein phosphatase 6 regulatory subunit 3-like isoform x1 | −0.7918434 |
Pleckstrin homology (PH) domain-containing protein/lipid-binding START domain-containing protein | protein enhanced disease resistance 2-like isoform x1 | −1.538706 |
Ankyrin repeat domain-containing protein 6 | Protein LHCP TRANSLOCATION DEFECT (probable) | −1.6666896 |
Protein kinase superfamily protein | serine threonine-protein kinase at5g01020 | −2.4678752 |
Methylation | ||
S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | Probable methyltransferase PMT26 (probable) | −0.5842584 |
sterol methyltransferase 2 | 24-methylenesterol c-methyltransferase 2-like | −1.4808227 |
Sterol 24-C-methyltransferase;sterol methyltransferase 1 | cycloartenol-c-24-methyltransferase 1-like | −1.2608874 |
Translation | ||
Polyadenylate-binding protein;Polyadenylate-binding protein 1;Polyadenylate-binding protein 5;Polyadenylate-binding protein 8 | Polyadenylate-binding protein RBP45B (probable) | −2.3749559 |
50S ribosomal protein L6 | 60S ribosomal protein L9-1 (probable),60s ribosomal protein l9-1-like | −0.5959295 |
50S ribosomal protein L18 | 50S ribosomal protein L18, chloroplastic (probable) | 1.8289892 |
40S ribosomal protein S6 | 40S ribosomal protein S6 (probable) | −0.3994783 |
30S rib PSRP-3 [Prochlorococcus marinus str. SB];rib PSRP-3/Ycf65 [Halothece sp. PCC 7418] | 30s ribosomal protein chloroplastic-like | −1.1850082 |
Polyadenylate-binding protein 8 | 33 kDa ribonucleoprotein, chloroplastic (probable) | −0.5907972 |
50S ribosomal protein L7Ae | h aca ribonucleoprotein complex subunit 2-like protein | −0.5377388 |
50S ribosomal protein L9 | 50S ribosomal protein L9, chloroplastic (probable) | −2.379722 |
60S ribosomal protein L4-1 | 60s ribosomal protein l4-1-like | −0.3906072 |
Nucleolar protein 58 | probable nucleolar protein 5-2 | −0.6824243 |
Metabolism | ||
Glucose-1-phosphate adenylyltransferase family protein | Glucose-1-phosphate adenylyltransferase large subunit 1 (probable) | 2.093622 |
N-succinylglutamate 5-semialdehyde dehydrogenase | delta-1-pyrroline-5-carboxylate dehydrogenase mitochondrial | 0.5348445 |
Threonine synthase | Threonine synthase, chloroplastic (probable) | −0.9644074 |
2-dehydro-3-deoxyphosphoheptonate aldolase (3-deoxy-d-arabino-heptulosonate 7-phosphate synthase) [Medicago truncatula] gb|AES98110.1| phospho-2-dehydro-3-deoxyheptonate aldolase [Medicago truncatula] | Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic (probable) | −0.5528278 |
2-dehydro-3-deoxyphosphoheptonate aldolase (3-deoxy-d-arabino-heptulosonate 7-phosphate synthase) [Medicago truncatula] gb|AES98110.1| phospho-2-dehydro-3-deoxyheptonate aldolase [Medicago truncatula] | −1.2349175 | |
alanine aminotransferase 2 | alanine aminotransferase 2 | −1.469876 |
Cytochrome P450 superfamily protein;Cytochrome P450 superfamily protein | sterol 14-demethylase-like, sterol 14-demethylase-like | −0.9758828 |
3-isopropylmalate dehydratase large subunit | aconitate cytoplasmic | −0.6276336 |
Isoflavone reductase homolog | isoflavone reductase homolog | 0.5225232 |
S-adenosylmethionine synthase 3 | s-adenosylmethionine synthase 2-like | −0.4216976 |
alanine aminotransferase 2 | Glutamate--glyoxylate aminotransferase 2 | 0.3580829 |
Aspartate aminotransferase, mitochondrial;aspartate aminotransferase 5 | Aspartate aminotransferase, chloroplastic (probable) | 0.3257779 |
ATP-dependent zinc metalloprotease FtsH | cell division cycle protein 48 homolog | −1.3560431 |
adenylate cyclase [Zea mays] | triphosphate tunel metalloenzyme 3 isoform x1 | −0.9491795 |
Acetolactate synthase | acetolactate synthase chloroplastic-like | −0.4911346 |
Methylenetetrahydrofolate reductase 1 | Probable methylenetetrahydrofolate reductase (probable) | −0.4068656 |
ornithine carbamoyltransferase | Pistil-specific extensin-like protein (probable) | −1.4021558 |
Linoleate 9S-lipoxygenase 6 | lipoxygenase | −1.3354193 |
GDSL esterase/lipase | gdsl esterase lipase at1g29670-like | −1.5272558 |
GDSL esterase/lipase | gdsl esterase lipase at5g33370-like | 0.6638832 |
Gamma-glutamyl phosphate reductase | delta-1-pyrroline-5-carboxylate synthase-like isoform x2 | 0.5598941 |
senescence-associated protein [Arabidopsis thaliana];Thiosulfate sulfurtransferase GlpE | Rhodanese-like domain-containing protein 15, chloroplastic (probable) | 1.1901923 |
3-phosphoshikimate 1-carboxyvinyltransferase | 3-phosphoshikimate 1-carboxyvinyltransferase 2 | −1.5891065 |
aminoacyl peptidase [Xanthomonas axonopodis] | probable glutamyl chloroplastic isoform x1 | 1.1461201 |
Eukaryotic aspartyl protease family protein | aspartic proteinase nepenthesin-1-like | −2.7812869 |
Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] gb|EEF30179.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] | ribulose- bisphosphate carboxylase oxygenase large subunit n- chloroplastic | 1.5090357 |
iron-binding protein [Pyrus pyrifolia] | Ferritin-1, chloroplastic (probable) | −1.68272 |
iron-binding protein [Pyrus pyrifolia] | Ferritin-2, chloroplastic (probable) | −1.8307396 |
Stress | ||
Protein GrpE | grpe protein mitochondrial | −1.6075834 |
Annexin D1 | annexin d1-like | 0.4671304 |
Heavy metal transport/detoxification superfamily protein | pollen-specific leucine-rich repeat extensin-like protein 1 | 3.9868143 |
Universal stress protein A-like protein | Universal stress protein A-like protein | 0.5305178 |
Glutathione S-transferase U8 | glutathione transferase gst 23-like | 0.7272462 |
IMP dehydrogenase/GMP reductase [Synechocystis sp. PCC 6714] | probable uncharacterized protein ycf23-like | 0.6426404 |
Glutamate dehydrogenase B | glutamate dehydrogenase b | 0.7839004 |
Plastid-lipid associated protein PAP / fibrillin family protein | fibrillin 1 protein | 0.6953284 |
membrane related | ||
Pyrophosphate-energized vacuolar membrane proton pump | pyrophosphate-energized vacuolar membrane proton pump 1-like | 3.7827212 |
CASP-like protein 4D1 | casp-like protein 4d1 | −2.1034703 |
Transmembrane emp24 domain-containing protein A | Transmembrane emp24 domain-containing protein p24beta3-like | −1.2165958 |
Aspartic proteinase;Aspartic proteinase A1 | aspartic proteinase-like | −1.2461262 |
GRIP and coiled-coil domain-containing protein, putative [Ricinus communis] gb|EEF50040.1| GRIP and coiled-coil domain-containing protein, putative [Ricinus communis] | uncharacterized abhydrolase domain-containing protein ddb_g0269086-like | −0.4647138 |
Signal peptidase complex subunit 3B | Signal peptidase complex subunit 3B (probable) | −1.5427202 |
Aquaporin-2;Aquaporin-like superfamily protein | aquaporin tip2-1-like | −0.4083201 |
ATP synthase subunit a, chloroplastic | Proteasome subunit beta type-1 (probable) | 1.6636887 |
Photosynthesis | ||
Plastocyanin A’/A’’ | plastocyanin a a | −1.5127553 |
Oxygen-evolving enhancer protein 2-1, chloroplastic | oxygen-evolving enhancer protein 2- chloroplastic | 0.4273438 |
Oxygen-evolving enhancer protein 2, chloroplastic | oxygen-evolving enhancer protein 2- chloroplastic | 0.4711001 |
Photosystem II CP47 reaction center protein | Photosystem II CP47 chlorophyll apoprotein (probable), photosystem ii 47 kda protein | −3.5313221 |
Glutamyl-tRNA reductase-binding protein, chloroplastic;pyridoxamine 5’-phosphate oxidase [Mycobacterium abscessus] | glutamyl-trna reductase-binding chloroplastic | −0.4534192 |
Protein folding | ||
Thioredoxin superfamily protein [Theobroma cacao] gb|EOX91756.1| Thioredoxin superfamily protein [Theobroma cacao];Thioredoxin superfamily protein | prostamide prostaglandin f synthase | 0.6359446 |
Calnexin homolog | calnexin homolog | −0.8004602 |
transcription | ||
potyviral VPg interacting protein 2 [Phaseolus vulgaris] | Protein OBERON 2 (probable) | 2.9606433 |
glycine-rich RNA-binding protein 2 | glycine-rich rna-binding, glycine-rich rna-binding | −1.1653803 |
Chromodomain-helicase-DNA-binding protein 1 | ATP-dependent helicase BRM (probable) | 2.1251746 |
Defence proteins | ||
Major pollen allergen Bet v 1-D/H | pathogenesis-related protein sth-2-like | 0.6196096 |
MLP-like protein 31 | pr-10 type pathogenesis-related protein | 1.6111262 |
Diverse roles or unknown roles | ||
Peptidyl-prolyl cis-trans isomerase-like 1 | peptidyl-prolyl cis-trans isomerase chloroplastic | 0.4489725 |
protein of unknown function (DUF1995) [Leptolyngbya sp. PCC 6406] | probable uncharacterized protein LOC104217371 | −0.6120353 |
14-3-3-like protein GF14 nu;14-3-3-like protein GF14-C | 14-3-3-like protein a, 14-3-3 protein 4-like | 1.8770383 |
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | 36.4 kDa proline-rich protein (probable) | −3.6962613 |
Fructokinase-2 | fructokinase 2 | −0.4746384 |
ubiquitin family protein | ubiquitin domain-containing protein dsk2b-like isoform x1 | −1.3615259 |
26S proteasome non-ATPase regulatory subunit 12 homolog A | 26s proteasome non-atpase regulatory subunit 12 homolog a-like | −1.1566838 |
DNA replication licensing factor MCM2 | DNA replication licensing factor mcm2 (probable) | −0.7461614 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Katsarou, K.; Adkar-Purushothama, C.R.; Tassios, E.; Samiotaki, M.; Andronis, C.; Lisón, P.; Nikolaou, C.; Perreault, J.-P.; Kalantidis, K. Revisiting the Non-Coding Nature of Pospiviroids. Cells 2022, 11, 265. https://doi.org/10.3390/cells11020265
Katsarou K, Adkar-Purushothama CR, Tassios E, Samiotaki M, Andronis C, Lisón P, Nikolaou C, Perreault J-P, Kalantidis K. Revisiting the Non-Coding Nature of Pospiviroids. Cells. 2022; 11(2):265. https://doi.org/10.3390/cells11020265
Chicago/Turabian StyleKatsarou, Konstantina, Charith Raj Adkar-Purushothama, Emilios Tassios, Martina Samiotaki, Christos Andronis, Purificación Lisón, Christoforos Nikolaou, Jean-Pierre Perreault, and Kriton Kalantidis. 2022. "Revisiting the Non-Coding Nature of Pospiviroids" Cells 11, no. 2: 265. https://doi.org/10.3390/cells11020265