Skip to main content
SpringerLink
Log in

Determination of the Amino Acid Sequence of a New Phospholipase A2 (MIDCA1) Isolated from Micrurus dumerilii carinicauda Venom

  • Published:
The Protein Journal Aims and scope Submit manuscript

Abstract

A new Phospholipase A2 (PLA2) from Micrurus dumerilii carinicauda venom was isolated and its primary structure determined. This new PLA2 showed a low enzymatic activity when compared with other PLA2s and it is moderately basic with an isoelectric point of 8.0. Its amino acid sequence showed the presence of 120 amino acid residues and its sequence was: NLIQFLNMIQCTTPGREPLVAFANYGCYCGRGGSGTPVDELDRCCQVHDNCYDTAKKVFGCSPYFTMYSYDCSEGKLTCKDNNTKCKAAVCNCDRTAALCFAKAPYNDKNYKIDLTKRCQ. The structural model of MIDCA1, when compared with other strong neurotoxic PLA2s, such as Naja naja, showed significant differences in the β-wing and neurotoxic sites, despite the high level of amino acid sequence similarity. These observations indicate a dissociation between the biological and catalytic activity of this new PLA2, supporting the view that other regions of the protein are involved in the biological effects.

This is a preview of subscription content, log in via an institution to check access.

Access this article

Log in via an institution

Price excludes VAT (USA)
Tax calculation will be finalised during checkout.

Instant access to the full article PDF.

Institutional subscriptions

Similar content being viewed by others

Abbreviations

MIDCA1:

Micrurus dumerilli carinicauda phospholipase A2 1

HPLC:

High performance liquid chromatography

TFA:

trifluoroacetic acid

MALDI TOF:

Matrix Assisted Laser Desorption/Ionization Time-Of-Fligh

EDTA:

Ethylenediaminetetraacetic acid

CNBr:

cianogen bromide

CRD:

Complementarity-determining region

References

  • A. Alape-Giron B. Persson E. Cedelund M. Flores-Diaz J. M. Gutierrez M. Thelestam T. Bergman H. Joernavall (1996) FEBS Lett. 380 29–32 Occurrence Handle10.1016/0014-5793(95)01543-4 Occurrence Handle8603741

    Article  PubMed  Google Scholar 

  • N. G. Anderson N. L. Anderson (1996) Electrophoresis 17 443–453 Occurrence Handle10.1002/elps.1150170303 Occurrence Handle8740157

    Article  PubMed  Google Scholar 

  • C. Bouchier P. Boyot F. Tesson O. Tremeau F. Bouet D. Hodgson J. C. Boulain A. Menez (1991) Eur. J. Biochem. 202 493–500 Occurrence Handle10.1111/j.1432-1033.1991.tb16399.x Occurrence Handle1761049

    Article  PubMed  Google Scholar 

  • S. Chwetzoff S. Tsunasawa F. Sakiyama A. Menez (1989) J. Biol. Chem. 264 13289–13297 Occurrence Handle2753914

    PubMed  Google Scholar 

  • F. F. Davidson E. A. Dennis (1990a) Biochim. Biophys. Acta 1037 7–15

    Google Scholar 

  • F. F. Davidson E. A. Dennis (1990b) J. Mol. Evol. 31 228–238

    Google Scholar 

  • E. A. Dennis (1994.) J. Biol. Chem. 269 13057–13060 Occurrence Handle8175726

    PubMed  Google Scholar 

  • B. R. Francis N. J. da Silva Junior C. Seebart L. L. Casais e Silva J. J. Schmidt I. I. Kaiser (1997) Toxicon 35 1193–1203 Occurrence Handle10.1016/S0041-0101(97)00031-7 Occurrence Handle9278969

    Article  PubMed  Google Scholar 

  • J. Halpert D. Eaker (1976) J. Biol. Chem. 251 7343–7347 Occurrence Handle1002692

    PubMed  Google Scholar 

  • B. Hawgood C. Bon (1991) NoChapterTitle A. T. Tu (Eds) Handbook of Natural Toxins: Reptile Venoms and Toxins Marcel Dekker New York 3–52

    Google Scholar 

  • F. J. Joubert N. Taljaard (1980) Eur. J. Biochem. 112 493–499 Occurrence Handle7460933

    PubMed  Google Scholar 

  • F. J. Joubert (1977.) Biochim. Biophys. Acta 493 216–227 Occurrence Handle880314

    PubMed  Google Scholar 

  • R. M. Kini H. J. Evans (1989) Toxicon 27 613–635 Occurrence Handle10.1016/0041-0101(89)90013-5 Occurrence Handle2665186

    Article  PubMed  Google Scholar 

  • G. Lambeau P. Ancian J. Barhanin M. Lazdunki (1994) J. Biol. Chem. 269 1575–1578 Occurrence Handle8294398

    PubMed  Google Scholar 

  • G. Lambeau J. Barhanin H. Schweitz J. Qar M. Lazdunski (1989) J. Biol. Chem. 264 11503–11510 Occurrence Handle2544597

    PubMed  Google Scholar 

  • G. Lambeau A. Schmid-Alliana M. Lazdunski J. Barhanin (1990) J. Biol. Chem. 265 9526–9532 Occurrence Handle2160984

    PubMed  Google Scholar 

  • M. H. Toyama A. M. Soares L. Wen-Hwa I. Polikarpov J. R. Giglio S. Marangoni (2000) Biochimie 82 245–250 Occurrence Handle10.1016/S0300-9084(00)00202-9 Occurrence Handle10863008

    Article  PubMed  Google Scholar 

  • H. Tsai S.-H. Wu T.-B. Lo (1981) Toxicon 19 141–152 Occurrence Handle10.1016/0041-0101(81)90126-4 Occurrence Handle7222082

    Article  PubMed  Google Scholar 

  • E. Valentin G. Lambeau (2000) Biochimie 82 815–831 Occurrence Handle10.1016/S0300-9084(00)01168-8 Occurrence Handle11086212

    Article  PubMed  Google Scholar 

  • C. J. Van Den Bergh A. J. Slotboom H. M. Verheij G. H. de Hass (1989) J. Cell. Biochem. 39 379–390 Occurrence Handle10.1002/jcb.240390404 Occurrence Handle2722967

    Article  PubMed  Google Scholar 

  • G. Singh S. Gourinath S. Sharma M. Paramasivam A. Srinivasan T. P. Singh (2001) J. Mol. Biol. 307 1049–1059 Occurrence Handle10.1006/jmbi.2001.4550 Occurrence Handle11286555

    Article  PubMed  Google Scholar 

Download references

Author information

Authors and Affiliations

  1. Department of Pharmacology, School of Medical Sciences, State University of Campinas (UNICAMP), Campinas, SP, Brazil

    Cháriston A. Dal Belo, Marcos D. Fontana & S. Hyslop

  2. Department of Physiology and Biophysics, Institute of Biology, State University of Campinas, (UNICAMP), Campinas, SP, Brazil

    Marcos H. Toyama, E. M. Carneiro & Antonio C. Boschero

  3. Department of Biochemistry, Institute of Biology, State University of Campinas, (UNICAMP), Campinas, SP, Brazil

    Daniela de O. Toyama & Sergio Marangoni

  4. Department of Biochemistry and Molecular Biology, Federal University of Ceará (UFC), Fortaleza, Ceará, Brazil

    F. B. Moreno & Benildo S. Cavada

Authors
  1. Cháriston A. Dal Belo
    View author publications

    You can also search for this author in PubMed Google Scholar

  2. Marcos H. Toyama
    View author publications

    You can also search for this author in PubMed Google Scholar

  3. Daniela de O. Toyama
    View author publications

    You can also search for this author in PubMed Google Scholar

  4. Sergio Marangoni
    View author publications

    You can also search for this author in PubMed Google Scholar

  5. F. B. Moreno
    View author publications

    You can also search for this author in PubMed Google Scholar

  6. Benildo S. Cavada
    View author publications

    You can also search for this author in PubMed Google Scholar

  7. Marcos D. Fontana
    View author publications

    You can also search for this author in PubMed Google Scholar

  8. S. Hyslop
    View author publications

    You can also search for this author in PubMed Google Scholar

  9. E. M. Carneiro
    View author publications

    You can also search for this author in PubMed Google Scholar

  10. Antonio C. Boschero
    View author publications

    You can also search for this author in PubMed Google Scholar

Corresponding author

Correspondence to Marcos H. Toyama.

Rights and permissions

Reprints and permissions

About this article

Cite this article

Belo, C.A.D., Toyama, M.H., Toyama, D.d.O. et al. Determination of the Amino Acid Sequence of a New Phospholipase A2 (MIDCA1) Isolated from Micrurus dumerilii carinicauda Venom. Protein J 24, 147–153 (2005). https://doi.org/10.1007/s10930-005-7838-1

Download citation

  • Issue Date:

  • DOI: https://doi.org/10.1007/s10930-005-7838-1

Key words:

Search

Navigation